EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03162 alignment
(8 sequences with 185 aa)


O13635_SCHPO/88-264 PLVPDNFGVVYPG--IIYRSACPRASNFNFLES-LHIRTIISLRQEEYSEEDLH--YFTKHHINYYHIAMPGSKHRKNDCISSS.SNPDISDVDDLVRKTLQLLLNKENWPVLLHCSRGKHRTGIVIGCLR-ALMNWPVGNRLQEYISFSHP-KEREVDEEYIQNFSSDPSLKSSLNDLKRYISD
Q9ZVN4_ARATH/53-215 LIPPLNFSMVDN---GIFRSGFPDSANFSFLQT-LGLRSIIYLCPEPYPESNLQ--FLKSNGIRLFQFGIEGNKEP--------.---FVNIPDHKIRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLR-KLQKWCLTSIFDEYQRFAAA-KARVSDQRFMEIFDVSSFSHIP--MSFSCSIR
YND2_YEAST/116-280 VIPPENFSHVVG---EIYRSSFPRQENFSFLHERLKLKSILVLIPEEYPQENLN--FLKLTGIKLYQVGMSGNKEP--------.---FVNIPSHLLTKALEIVLNPANQPILIHCNRGKHRTGCLIGCIR-KLQNWSLTMIFDEYRRFAFP-KARALDQQFIEMYDDDEIKRIAS-KNNWLPLQ
YNJ9_YEAST/67-236 IVPPLNFCPVER---YLYRSGQPSPVNFPFLLN-LKLKTIIWLSNE-EPQDTLLE-FCDTHRINLQFAAINPDAGEDD------.-NPWDGLTEHSIINVLQTIVTQENYPLLVCCGMGRHRTGTVIGCLR-RIMGWNLASVSEEYRRFTGSRGGRILVELLIEAFDTNLVKIDKNKAPSWLLTA
YNF6_YEAST/3-169 YIPPLNFSPVVSTDVSLYRSGYPMPLNYSFIKHQLHLKTIIYIGDKDRPLEEYQS-FLESEKIKYYHIFMDSSRD---------.-----EGIQERMNQVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWSTAGICQEYGLFSGG-MKDGVDLEFITMFETNLKIPRNV-IPGFAKHC
Q9U0Z9_LEIMA/398-559 LVPPFRFARVES---GVYRGAYPVLRNFPYIRR-LRLRTMVSLIPEPPTYDLKC--FAEAEHIQLHHIHAERAKG---------.---EVQLLPSELSEALQLIMNKDMHPLYIHCLDGRHVTGLVIMALR-KLLQWDANVANAEFQRFTRE---VQDEAAFIADYTGPLLVPPHLPAWLWGGSI
Q12454_YEAST/3-180 LVTPLQFSTVQP---NLYRGSYPREINLPFLRT-LRLKYILSLTPEPLSTDPLMVKFCEENNIKTIHIKCQSERKADKTKPKIKrKKKTVPIEYDVVVRCVKFLIDKGHYPCYMHCTNGELIISLVVACMR-KFSYWSTVSILNEFLVYNSS--INIHERNFIENFNSEIEVDDLDIKDKVPWIT
YCY5_YEAST/62-220 VLRMSDFSAAAV---PVKSSSVSNANLYSNNNSTLSLQEEKKKSTANGSQNSTT--G-DPVIQEELAYHLTDNDD---------.---LMLIKSTCLKRTFKTLLNVDNYNVLLVD-----KTALVIGILR-KIQKWNIASIINEYRLFSGK-NRNYFAETFLEIINIEIEQEKDNKTIVDNKAK