EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03136 alignment
(5 sequences with 332 aa)


Q9RJ61_STRCO/128-453 VARHGEFSRLADILIPFLVTRQLLCGAGKV--LQTPRGAVYCVSQRAEHIWEGVSSATTRSRPIINTRDEPHADAERYRRLHVIVGDSNMSETTMLLKVGATDLVLRMIEAGTVMRDLTLENPIRAIREVSHDITGRRKVRLASGREASALEVQREYYEKAVDFCERRG--IRTGTVERVLELWGRTLDAIEAEDLDRIGTEIDWVMKYKLLERYRAKHNMTMSHPRVAQIDLAYHDIHRRRGLYYLLEKKGQAARVANDLKIFEGKSVPPQTTRARLRGDFIRRAQEQRRDFTVDWVHLKL--NDQAQRTVLCKDPFRSVDDRVEKLIAGM
Y2124_MYCBO/128-452 IVRAGEFSRISDVLLPFLVTRQLICGAGKV--LQTPKAATYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIESGVAFRDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYTRAVEHLQTR---EPNAQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKIAQLDLAYHDIKRGRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARLRGEFISAAQEAGRDFTVDWVHLKL--NDQAQRTVLCKDPFRAVDERVKRLIASM
O87595_STRCO/155-484 MKRETAFSDIVRHLTPFFVSRQVFTGAGRVGIGQDGHEHGFQLSQRADYFEVEVGLETTLKRPIINTRDEPHADAEKWRRLHVIIGDANLSEISTYLKLGTTALVLSMIEDGFIAVDLAVDQPVRTLHQVSHDPTLKHLVTLRSGRTLTAVQLQMEYYELARKYVEERYGADADDQTKDVLGRWEDTLNRLEN-DPMSLAGELDWVAKRELMEGYRRRDNVDWDAARLHLVDLQYADVRPDKGLYNRLVDRGRIKRLLDENEVERARTKPPEDTRAYFRGRCLEQYADDVAAASWDSVIFDLPGRDSLQR-VPTLEPLRGTRNHVKELLDRC
Q9RAW9_9ACTO/164-492 MARSTPFGEIVRNLTPFFVSRQVVCGPGRVGLGVDSREAGFQISQRADFFEVEVGLETTLKRPIINTRDEPHADPEKYRRLHVIIGDANMSEVATYLKVGTTSLVLAMIEDGWFSVDLSVDGPVAALRAISHDPSLKHLVTLRDGRKMTAVQLQMEYFEQARKYVENRFGSDVDPQTADVLSRWESVLGRLEV-DPMSCARKLDWVAKLSILEGYRSRDALAWDSPRLELVDLQYHDVRPDKGLYNRLVERGRFDLVVSEDEVTRAMTEPPEDTRAFFRGRCLARYPQQVAAASWDSVIFDI-GRDSLQR-VPTLEPLRGTRAHVDELLDRC
YTH6_RHOER/1-327 MSRATPFSAVINGLTPFFASRQVICGSGRVGIGQSGDEAGFQLSQRADYIEVEVGLETTLKRGIINTRDEPHADADKYRRLHVIIGDANLAEMSTYLKVGTTALVLDLIEAGVHLTDLQLARPVTAVHHISHDPTLRATVALADGRELTGLALQRIYLDRVDKFMSAE-GND-DPRVADLLEKWAMVLDLLER-DPMECAHLLDWPAKLRLLEGFRNREGLNWSAPRLHLVDLQYSDVRLDKGLYNRLVARGSMERLVSEQAVLDAVDTPPTDTRAYFRGECLRKFGADIAAASWDSVIFDL-GGDSLVR-IPTLEPLRGSKAHVGKLLESV