EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03119 alignment
(32 sequences with 30 aa)


Q9ZFY7_THEAQ/356-381 ENCPECGHALLKE-G--KVHRCPNPL-CPA
DNLJ_THESK/407-432 ENCPECGHALIKE-G--KVHRCPNPL-CPA
Q9ZFY2_9DEIN/322-347 ENCPECGHHLVKE-G--KVHRCPNPL-CPA
DNLJ_THETH/410-435 ETCPECGHRLLKE-G--KVHRCPNPL-CPA
Q9ZFY5_THEFI/350-375 ETCPECGHRLLKE-G--KVHRCPNPL-CPA
Q9ZFY6_THETH/361-386 ETCPECGHRLLKE-G--KVHRCPNPL-CPA
DNLJ_THEFI/407-432 ETCPECGHRLVKE-G--KVHRCPNPL-CPA
DNLJ_THESC/407-432 ETCPECGHRLVKE-G--KVHRCPNPL-CPA
Q9ZFY3_9DEIN/353-378 ETCPECGHRLVKE-G--KVHRCPNPL-CPA
DNLJ_STRCO/421-450 AECPECGTPLKAMKEGDIDLRCPNARACPA
DNLJ_MYCTU/416-445 TTCPECGSPLAPEKEGDADIRCPNARGCPG
DNLJ_MYCLE/416-445 TTCPECGTTLAPEKEGDADIRCPNARSCPG
Q99540_HUMAN/413-440 VACPACGSELVHI-SGEVALRCINPF-CAA
DNLJ_BACSU/402-429 TECPECGSELVRI-EGEVALRCINPE-CPA
DNLJ_BACST/401-428 THCPECESELVRL-EGEVALRCLNPN-CPA
DNLJ_AQUAE/436-463 KYCPSCGSELVKL-PEEVAIRCINIS-CPA
DNLJ_THEMA/407-435 DKCPVCGGKVGKLNPDEVAIRCLNPH-CPA
DNLJ_SYNY3/405-432 SHCPACGSPLVRP-LEEAVIRCVNSS-CSA
DNLJ_RHOMR/448-475 ERCPSCGSQLVRL-PGEADYYCVASD-CPA
Q9RSQ5_DEIRA/416-443 THCPVCGHEAVRA-EGDANTYCPNPA-CPA
DNLJ_HELPJ/398-423 KVCPICSHELLCE-E--IFTYCQNLN-CPA
DNLJ_HELPY/398-423 KVCPICSHELLCE-E--IFTYCQNLN-CPA
DNLJ_RICPR/411-439 VFCPSCNSKLRYVSE-DIIIRCDNGLNCPA
Q9RBF2_ALTHA/406-434 TTCPICDSHVE-KVEGEAVARCTGGLVCPA
DNLJ_ECOLI/406-434 THCPVCGSDVE-RVEGEAVARCTGGLICGA
DNLJ_HAEIN/416-444 TNCPVCDSQII-RIEGEAVARCTGGLFCAA
DNLJ_ZYMMO/432-460 HRCPVCDSVAR-REEGEVAWRCTGGLICPA
DNLJ_CHLTR/401-426 SLCPVCHEPVVKE-K--VSVRCVNPL-CSG
DNLJ_CHLPN/402-429 EFCPVCHSHVVRE-EDRVSVRCVNPE-CVA
DNLJ_BORBU/394-419 DNCPACKTAVVKE-G--AHFFCPNNN-CPS
DNLJ_MYCPN/395-422 THCPACQAPLVQY-KDEVDQYCTNER-CDQ
DNLJ_MYCGE/396-423 KYCPSCNSKLVKI-VDEVDQYCTNET-CKE