EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03118 alignment
(14 sequences with 68 aa)


RPOA_HELPY/246-313 GDYAQRDDAKDLSAKIESMNLSARCFNCLDKIGIKYVGELVLMSEEELKGVKNMGKKSYDEIAEKLND
RPOA_MYCSP/255-322 ENKEKKEREIKSTTPITKLGLSVRSENALRRAKYNTVEEVLGLSDEELSNIKNLGKKSIQDIIEKRNE
RPOA_MYCGE/254-321 QEKAEERKVKSFAKQIEELDFTVRTFNCLKRSGIHTLQELLSKSLTDIREIRNLGKKSEREIIKKVQE
RPOA_BACSU/238-305 VEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKTEEDMMKVRNLGRKSLEEVKAKLEE
RPOA_MYCTU/236-303 PSPAEADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQ
RPOA_ODOSI/237-304 NKTLSAPKNPHTNIAIEELHLSVRAYNCLKRAQINTIGDLLKYSPEKLQELKNFGRKSADEVFTTLKN
RPOA_SYNP6/232-298 HTADPEP-TPESQTPIEDLQLSVRAYNCLKRAQVNSVADLLSYTYEDLLEIKNFGQKSAEEVVEALER
RPOA_CYAPA/232-299 DDSTEQTEDKISQIPIEELQLSVRAYNCLKRAQIHSIGDLLNVSQEELLEIRNFGQKSAKEVIDALQK
RPOA_CHLTR/272-339 EKENKDDILHKLVLGINEIELSVRSTNCLSNANIETIGELVIMPEPRLLQFRNFGKKSLCEIKNKLKE
RPOA_SHESP/241-308 QKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLAS
RPOA_MARPO/260-327 DIEKMTKDVAFKHIFIDQLELPARAYNCLKKVNVHTIADLLHYSEDDLIKIKNFGKKSVEQVLEALKK
RPOA_PINTH/259-326 DTGETKEKIAFQLIFIDQLELPPKTYNSLRRANIHTLLDLLNYSREDLMRIEHFGKESVEQVLEVLQK
RPOA_PEA/262-328 KLRKNQKEITLKSIFIDQLELPPRIYNCLKKSNIHTVLELLNKSQEDLMKIEHFRVEDLKFILNILQ-
RPOA_AGRCR/259-326 NLKKNKKGIPLNCIFIDQLELTSRTYNCLKRANIHTLLDLLSKTEEDLLRIDSFRMEDRKHIWDTLEK