EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03113 alignment
(2 sequences with 124 aa)


VNS2_ORSVW/1-124 MSTPNCKITTQRLVVNDMKPLSIETEIISLTKEIITHTFIYLINHECIVRKLNEQQATFTFLVNYEMKLLHKVGSTKYNRYTEYNSKYGTFPMPIFINHAGFLECIGIKPTRNTPVIYKYDLNP
VNS2_HRSVA/1-124 MDTTHNDNTPQRLMITDMRPLSLETIITSLTRDIITHKFIYLINHECIVRKLDERQATFTFLVNYEMKLLHKVGSTKYKKYTEYNTKYGTFPMPIFINHDGFLECIGIKPTKHTPIIYKYDLNP