EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03073 alignment
(14 sequences with 159 aa)


P74502_SYNY3/5-153 P----AWLWIGLIAFALAFVCNRLSPRDLR.--WFNRLRRPSWLTFEW.AIPFIWIAIFIAGAISATLAWNATADPGHRWG--LMVGYLLLELTVMAYTPVMCKLRSLRVGSIIGATGFFVGLALVIAVSQVSTTAFGFLVPFLLWSPIGTYVTWAMIP
Q93367_CAEEL/388-545 TQDTRNAIISSLIPAGAAVAAFASFAKDQQvADWWAALKKPNWAPKDVrVYSAVDLLTLSPLGYASYLVYKNGGGFDYNDTKLALGLYGASVTLAVATIPIVKKKE-LGCLWKNTTVVSLTAAAASFAFYKIDKKAGLLVVPFAVWTAFYAYLAYSIKK
O94327_SCHPO/5-162 YQVFTSISKNWWSASLVPVACGWFIGNSYKpRKDYENKKQPKFHPPAS.AFGPAWTLLYLTMGYASHLAYKADPLMITNASRNGSILYIAQLAANFAWMPLFYGLAKPKLALADLGILTGLVGWLAKTWWPLAPTASKWLIPYLAWLGYAGYLVSNVTN
Q9WXA8_ACIRU/8-156 WG---PVLVAAVTATVVAGAGGAASTIGP-.--WYRGLRKPSWQPPPW.LFGPVWTLIFALIAGAGVIGWEAAPSVTSAT--FLLVLFGINAVFNVAWSVLFFTMRRPDWALIDIAPLWLTILALVVTTAQFAGTAALLLMPYLLWVTFAGYLNLVIVR
O28797_ARCFU/3-150 I----LKLVASILAVLAIGFAGSFFTAQSV.QTWYAGVEKPFFTPPNW.LFGPAWTLLYFLIGIVLYIAW--ENGFWNDS--RVKATFFTQLGLNFLWSILFFGLQNPLAGLVDIIALDIAVILTIVYIYHHSK-ASLLLLPYLGWILFASALNFAIYL
Q9ZGF6_HELMO/10-165 VAINVLKLIASIIICQVASLIGAKFTIHPAnIIWYAQLAKPAFNPTND.AFYPVWIVLYTLMGIALYLVWR--KNLEQGEVKIALSLFSAQLLLNVLWSWVFFELQAPFYAFFEIILLAIVILSTVIAFYKQSELAAVLMMPYFLRVCYEAILNYYIWQ
Q13850_HUMAN/5-156 W----VPAMGFTLAPSLGCFVGSRFVHGEG.LRWYAGLQKPSWHPPHW.VLGPVWGTLYSAMGYGSYLVWKELGGFTEKAV-GSPGPLHWAAGPELGMAPHLLGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWR
BZRP_MOUSE/5-156 W----VPAVGLTLVPSLGGFMGAYFVRGEG.LRWYASLQKPSWHPPRW.TLAPIWGTLYSAMGYGSYIVWKELGGFTEDAM-VPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWR
BZRP_BOVIN/5-156 W----VPAVGFTLLPSLGGFLGAQYTRGEG.FRWYASLQKPPWHPPRW.ILAPIWGTLYSAMGYGSYMIWKELGGFSKEAV-VPLGLYAGQLALNWAWPPLFFGTRQMGWALVDLLLTGGMAAATAMAWHQVSPPAACLLYPYLAWLAFAGMLNYRMWQ
Q9R9N7_RHIME/6-152 L----LVLVAFEVASFAAAATGVIFRPGD-.--WYKQLNKPRWRPPDW.LFAPVWAVLYASIGLSGWLVW-QEAGIAGAA--LPLGTYAVQLLLNAAWTPIFFGLHRPGLAAVEIMVLWAAILATTVMFHPVNAAAALLLVPYLAWVSFAAALNLSIWR
Q9VPR1_DROME/10-162 I----LRIAGAVILPNLGGIYNGRLTRQHL.QSWYANLKFPSFKPPNS.VFAPMWISLYAGMGYGSYLVWRDGGGFAGEAAKLPLIAYGTQLALNWAWTPIFFGQHNIKGGLIDIVALTAAASACGVLFYRVNKTAGLLFVPYVAWLGFATALNYAIWK
Q9RFC8_RHOSH/5-148 W----ALFLTFLAACGAPATTGALLKPDE-.--WYDNLNKPWWNPPRW.VFPLAWTSLYFLMSLAAMRVA-QLEGSGQ-----ALAFYAAQLAFNTLWTPVFFGMKRMATALAVVMVMWLFVAATMWAFFQLDTWAGVLFVPYLIWATAATGLNFEAMR
CRTK_RHOCA/3-150 L----TLFAVYFVACACAGATGAIFSPGA-.--WYDSLKKPSWVPPNW.LFPVAWSTLYILMSISAARVS-GLAMENELAV-LGLAFWAVQIAVNTLWTPIFFGLHRLAGGMLVLVLLWLSVFATCVLFWSVDWLSGLMFVPYVIWVTVAGALNFSVWR
O34694_BACSU/5-152 VG----ALAVFVITYALFSAAGYLFPVDQ-.-EWYNSLKKPDWTPSGT.AIGIIWAILFALISLSAAIVYAAFSFKGAKS---FWFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLIIAKKYSRAASYLLLPYFLWSAFATFLSFTINS