EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03071 alignment
(6 sequences with 465 aa)


Q21450_CAEEL/1-437 MHISSKITFIFVLIYFSWNFYIQN-GFTNKAIVKEELR---------LLKEMDEAGSRLEKLLKVEK---EHMERLSETMN--RATR----LRITPNSNNP-----NNWPHPIPVIVFSCNRPDSVRAHVEKLIMYR-PSAQQFPITVSQDCDNESVKKEVEKFGNSVNYVKHPPGESVKIEIP-TNLQKFKPYYYISRHYKLALNHIFSNSNNYSSVIITEDDLDIAPDFFSYFSNTRYLLEKDPSLWCVTAWNDNGKPENIDLKSNATLYRSDFFAGLGWMMTRKTWEELEPIWPNGFWDDWMREPVQRKQRQCIRPEISRTGMMKYGKEGTSKGQFFSDHLEKIKVNDLPVDFSQINLDYLQKNEFESRLSLDI-RNAVPVDIDDITYPDWKPDYEGMKAIIYYTGRTDFVAKADRLSLMHDFKAGVPRTAYNGIVTCFYKG-TRIFLVPDRSKVPGYDSSW
MGAT1_CAEEL/1-441 MHAVTKIFIIFIFVFILWTLYVEN-DITNRTRNTDNID------------DLLESANRLERLLKFEA---KKIAALAEDVHKIRANRKGKHVIMEEMVSQD----LKQWKDPIPVLVFSCNRAMAVRDHVEKLIRYR-PSQEKFPIIVTQDCDNENVKNEVKKFGDKVEYIKHLAGDKANITIP-PSHRQYTAYYRIARHYKLALNHVFVDKG-YSSVIITEDDLDISPDFFSYFSSTRYLLENDEKLWCVTAWNDNGKQENIDMTAASTLYRSDFFAGLGWMMSSKTWHELEPIWPVGFWDDWMRDPARRKDRQCIRPEISRTGMMSYGKEGASKGQFFSKHLAKIKVNDKYINFGKIDLDYLLPANFAKKTNLEVMKEAVELSIDNVASFVLSSENKGKSVRVMYDGNIDYIRKADKLHIMHDFKAGVPRTAYDGIVTCFING-IRIYLVPDRTKVSAYNPDW
Q9V944_DROME/10-457 IGFLVTWTYATYYLLLRQTGIHTSRHQSLQAYKLNSQARDANMQSHHLAKNVFEFV--KLKYLEKQPPSVASTPQISIIAAEISAELPEQHVAKSATARIPTKTYLANGEPVFPVVVFACNRVS-VKKCIDNLVQYR-PSVEQFPIIVSQDCGDEPTKEAILSYGKQVTLIEQP--DLSDITVL-PKEKKFKGYYKIARHYGWALNTTF-AVG-FEFVIIVEDDLNVAPDFFEYFLGTHKLLKQDPSLWCVSAWNDNGKAAVVDAAQPELLYRTDFFPGLGWMLTKDLWAELSVKWPKSFWDDWIRHPAQRKDRVCIRPEISRT--RTFGKIGVSNGLFFDKYLKHIKLSEDFVQFTKINMSYLLKDNYDNTFLRRV-YTYPIVTYDELRRNLIR--IEG-PVRIQYTTREQYKRTTKMLGLMDDFKSGVPRTAYHGIVSFYYNK-RRVHLAPNAN-WKGYELSW
MGAT1_HUMAN/12-444 WGAILFVAWNALLLLFFWTRPAPGRPPSVSALDGDPAS---------LTREVIRLA--QDAEVELER-QRGLLQQIGDALSSQRGRVPT--AAPPAQPRVP----VTPAPAVIPILVIACDRST-VRRCLDKLLHYR-PSAELFPIIVSQDCGHEETAQAIASYGSAVTHIRQP--DLSSIAVP-PDHRKFQGYYKIARHYRWALGQVFRQFR-FPAAVVVEDDLEVAPDFFEYFRATYPLLKADPSLWCVSAWNDNGKEQMVDASRPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRQGRACIRPEISRT--MTFGRKGVSHGQFFDQHLKFIKLNQQFVHFTQLDLSYLQREAYDRDFLARV-YGAPQLQVEKVRTNDRK--ELG-EVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRG-RRVHLAPPPT-WEGYDPSW
Q9XGM8_ARATH/13-443 IPAAFMFIYIQMRLFQTQSQYADRLSSAIESENHCTSQ---------MRGLIDEVSIKQSRIVALED----MKNRQDEELVQLKDLIQT--FEKKGIAKLTQ----GGQMPVAAVVVMACSRADYLERTVKSVLTYQTPVASKYPLFISQDGSDQAVKSKSLSY-NQLTYMQHL--DFEPVVTERPGE--LTAYYKIARHYKWALDQLFYKHK-FSRVIILEDDMEIAPDFFDYFEAAASLMDRDKTIMAASSWNDNGQKQFVHD--PYALYRSDFFPGLGWMLKRSTWDELSPKWPKAYWDDWLRLKENHKGRQFIRPEVCRT--YNFGEHGSSLGQFFSQYLEPIKLNDVTVDWKAKDLGYLTEGNYTKYFSGLV-RQARPIQGSDLVLKAQN--IKD-DVRIRYKDQVEFERIAGEFGIFEEWKDGVPRTAYKGVVVFRIQTTRRVFLVGPDS-VMQLGIRN
Q9ST97_TOBAC/15-445 ILAAVAFIYIQMRLFATQSEYADRLAAAIEAENHCTSQ---------TRLLIDQISQQQGRIVALEE----QMKRQDQECRQLRALVQD--LESKGIKKLIG----NVQMPVAAVVVMACNRADYLEKTIKSILKYQISVAPKYPLFISQDGSHPDVRKLALSY-DQLTYMQHL--DFEPVHTERPGE--LIAYYKIARHYKWALDQLFYKHN-FSRVIILEDDMEIAPDFFDFFEAGATLLDRDKSIMAISSWNDNGQMQFVQD--PYALYRSDFFPGLGWMLSKSTWDELSPKWPKAYWDDWLRLKENHRGRQFIRPEVCRS--YNFGEHGSSLGQFFKQYLEPIKLNDVQVDWKSMDLSYLLEDNYVKHFGDLV-KKAKPIHGADAVLKAFN--IDG-DVRIQYRDQLDFEDIARQFGIFEEWKDGVPRAAYKGIVVFRYQTSRRVFLVGPDS-LQQLGNED