EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03039 alignment
(2 sequences with 226 aa)


IL12A_MOUSE/1-215 MCQ-SRYLLFLATLALLN---HLSLARVIPVS--GP---ARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPP--VGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA
IL12A_MARMO/1-223 MCPSARSLLLLASLVLLE---HLGSARNLPRSTPVPAVSQECHNLSQTLLSTVDSALQNAIEILEYYPCSAEEVNHEDITKNRTNTVKACLPQELAQNENCLASRETSFIIKRSSLTSGRTSWNTTLCFSSIYEDLKMYQLELKAISEKLLMDPKGQIYEDKALLAAVDYLMQAVNVNNETVPQTPSPEAPSSNLYRTKTKLCILLHALRIRAVTINRVMSYLNSS