EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03037 alignment
(4 sequences with 90 aa)


KM11_TRYBB/1-90 MATTYEEFAAKLDRLDAEFAKKMEEQNKRFFADKPDEATLSPEMKEHYEKFEKMIQEHTDKFNKKMREHSEHFKAKFAELLEQQKNAQFP
KM11_TRYCR/1-90 MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAKFAELLEQQKNAQFP
Q9XZH5_LEIBR/1-90 MATTYEDFAGKLDRLDDEFNKKMQEQNAKFFADKPDDSTLSPEMKEHYEKFEKMIQEHTDKFNKKMREHSEHFKQKFAELLEQQKNAQYP
KM11_LEITR/1-90 MATTYEEFSAKLDRLDEEFNRKMQEQNAKFFADKPDESTLSPEMKEHYEKFERMIKEHTEKFNKKMHEHSEHFKQKFAELLEQQKAAQYP