EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03017 alignment
(14 sequences with 77 aa)


Q9ZUQ3_ARATH/516-588 RRTNPKCLLV-NWSGP.-EDIIGEGRILSSDPDDVV-NDCRLGPVDLKVLVEAANTPDAFLWRPAPNMYTITEAVGQ
Q9SK21_ARATH/270-342 RKSHRKCVFV-DWSET.-DENVGEGRILSSDPDDIV-NDCRLGPTDLKVLVETAYQPDAFLWRPAHKIFNMKEAVGH
O82334_ARATH/463-535 QGSQPKCILM-DWAGT.-DATVVEGCIISSDPDEIV-NGSRLGPTDVKVLIDTAIVPEAYLWRPAINMEIMEKAVGQ
Q9SIL1_ARATH/688-760 KRTQPKCFLL-DWAGS.-YAKVAEGCIISSDPGELV-NDCRLGPTDVKVLIDTVIEPEAFLWRPAANMFTIEKAVGH
Q9SI94_ARATH/157-231 SSAPPDRILIFDWNVE.-DLIVAEGHLISSDPKELLANNIPLGPNAALVKVDKIFHKDAYLWRPTSEMILMGDALHE
O82334_ARATH/687-759 LKANQKCKLM-DISGK.-KRVVGAGRVHSIDPDQKV-HHVRLGENAARVWVDVVNVDDTAVWRPSDEIEYMRDSLGS
Q9ZUQ3_ARATH/697-769 SKENMKCKLM-DITGK.-KRVVAEGRWATNDPKQKV-HFVPLGDNVVKVWVDIVKVSDVKVWRPSDEVEIMEDALGT
Q9SIC0_ARATH/292-362 RKVSE------DIRTVlWKSIEARFALDQPLYSDQCVHHVPLGPNACRVWVDVVIVKDAAVWRQSTEIEYMEDALGT
Q9XEB3_ARATH/262-334 KGSKQKCFLL-DIDNS.-GKKVAVGRVSSIDPAEKV-HHVPLGSNASKVWVEVSKVDGARVWRPNSEVTFIADAVGT
Q9SYE6_ARATH/107-179 KSAKKKCIML-DYKNG.-RERVAEGRVCTSNPSDTV-HHMPLGPNASKVCVEVSKIGDAAVWRPNSEIQTIADAVIN
Q9SI94_ARATH/268-340 SNDQRKRLLL-DCNGS.-GEIVAEGRICSTNPEDKV-HFVPLGPDASKVWVQVLKIGSAKVWRPNSEVHFVGDALGT
Q9SK21_ARATH/369-439 --KGNKCKLL-DLKNA.-EVIVAEGRWETQEPSALV-NGLPLGPKAVKVFVDSVKQPDTSLWRPTAEISYLEDCLMA
Q9SI94_ARATH/59-131 SKVVTRCQLL-DWCSN.EDIIVGEGEFCSAERTYKI-GRIPL-KNAAVVIVNFVSKEDAPVWRPTATIFSLGNAMGT
Q9ZUK5_ARATH/279-351 SGLAAK-KLL-DWCSD.DDVVVGEGEFCSAKQMYKI-GRIPLGRNVAAVIAKSVLDATASLWRPTPSVFTLGEALRN