EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02998 alignment
(7 sequences with 87 aa)


Q86553_9RETR/2-88 MEEAPRRRPGGTQEIAGIFQFYEDWECWDYVSQRVPDEILQRWLAMLTNQRLRRLVITEAQKWVWRNPKAPVRKNCGCRACNPGWGS
TAT_VILVK/1-87 MEEVPRRQPGGLVEVEGVFQFYEDWECWDYVSQRVPGERLQRWLAMLTNNQLRRQVIREAQIWMWKHKGAAVRRNCGCRLCNPGWGS
Q9W9Z0_9RETR/1-87 MEEAPRRYPGGNRDADGIFQYYEEWECWDWVSQRVPGDILQRWLAMLTNSQLRRKVVKEMQRWIWRNPRAPIIRNCGCRLCNPGWGS
Q65930_CAEV/2-87 SEELPREREVSPEEAV-RNIWERERDTWQRASIRVPGETLQRWLAMLRLGRHRRKVLREMQKWMWKHPKAPVIRPCGCRLCNPGWGS
Q9W8F7_9RETR/2-87 TEELPQRREARPEERG-LSLWERERDTWQWTSIRVPGEMLQRWLAMLRLGRNRGKVYREMQKWMWRHPKATVIRPCGCRICNPGWGT
TAT_CAEVC/2-87 SEELPQRRETHPEELV-RNVRERERDTWQWTSIRVPEEILQRWLAMLRSGRNRKKVYREMQKWMWIHPKGPVIRACGCRLCNPGWGT
Q9W959_9RETR/2-87 NEEAPQRREIHQEDLV-RDIWERERDAWQWISVRAPGEVLQRWLAMLKSGRNRKRVLREMQKLMWRYPKAPVIRPCGCRLCNPGWGT