EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02975 alignment
(2 sequences with 123 aa)


DHML_PARVE/65-187 dPRAKWQPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASWVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKA
DHML_METFL/64-185 .GREGYKPQDKDPKSCDYWRHCSIDGNLCDCCGGSLTSCPPGTELSPSSWVASCFNPGDGQTYLIAYRDCCGKQTCGRCNCVNVQGELPVYRPEFNNDIVWCFGADNDAMTYHCTVSPIVGKA