EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02969 alignment
(12 sequences with 68 aa)


Q8SR29_ENCCU/1-65 .MLFSKETLKSFAQSKGISNIDDDALRVLSQDLEYRIKEVCQEGSKFMVGSKRTKLSIDDINYA-.LT
Q8LRG9_ORYSA/1-68 mSIVPKETIEVIGQSVGIANLPADVSAALAPDVEYRLREIMQEAIKCMRHAKRTVLTADDVDSALsLR
Q9MAU3_ARATH/1-68 mSIVPKETVEVIAQSIGITNLLPEAALMLAPDVEYRVREIMQEAIKCMRHSKRTTLTASDVDGALnLR
Q9SLJ8_ARATH/1-64 .-MVTKESIEVIAQSIGLSTLSPDVSAALAPDVEYRVREVMQEAIKCMRHARRTTLMAHDVDSA-.LH
TAF6_YEAST/9-74 tIWSPQDTVKDVAESLGLENINDDVLKALAMDVEYRILEIIEQAVKFKRHSKRDVLTTDDVSKA-.LR
O74462_SCHPO/3-68 lTVWNIESIKDVAEMLGIGNLADEPAAAIAMDLEYRIHQVVQEATKFMVHSKRTVLTSADISSA-.LR
Q9DDC0_PLEWA/11-76 nTLFPTESMKVIAESIGISQVPEETCQLLTEEVSYRIKEITQDALKFMSVGKRQKLTTCDIDSA-.LR
TAF6_XENLA/9-74 nTLLPSESMKVISESVGISQMSEETCQLLAQEVSFRIKEVTQDALKFMHVGKRQKLTPSDIDAA-.LK
TAF6_HUMAN/11-76 nTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYA-.LK
TAF6_DROME/18-83 gSSISAESMKVIAESIGVGSLSDDAAKELAEDVSIKLKRIVQDAAKFMNHAKRQKLSVRDIDMS-.LK
TAF6L_HUMAN/9-73 fVEIPRESVRLMAESTGL-ELSDEVAALLAEDVCYRLREATQNSSQFMKHTKRRKLTVEDFNRA-.LR
Q9GZI6_CAEEL/24-85 tPIFTQTA----AEMLGITSLNTEAAELLEFLSREKLKEIVRLSAKWTQKSARRRMAVADVEHA-.IR