EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02962 alignment
(3 sequences with 126 aa)


Q9RYT1_DEIRA/2-126 PHLTLEYTDNLPEP-RIPELLQKLNGVLLARPDIFPVGGIRARAYRLSEYALADSSEPSDAFVHLRLQIGAGRSEEVKKETGDALFAVLTDHFAAEFAQRGLMLSAEISEFSEAGTWKKNNIHARY
Q9RE14_KLEPN/2-125 PHFFAECTDKIREQGDLPDLFSKVKDALAAS-GIFPIGGICSRAHWLDTWQMADGQH-DYAFVHMTLKIGAGRSLESRQDVGDMLFTLIKAHFAALMESRYLALSFELDELHPTLNYKQNNVHALF
HPCD_ECOLI/1-124 PHFIVECSDNIREEADLPGLFAKVNPTLAAT-GIFPLAGIRSRVHWVDTWQMADGQH-DYASVHMTLKIGAGRSLESRQQAGEMLFELIKTHFAALMESRLLALSFEIEELHPTLNFKQNNVHALF