EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02953 alignment
(22 sequences with 67 aa)


IM09_YEAST/12-77 FQKVVEQKQMKDFMRLYSNLVERCFTDCVNDFTT-SKLTNKEQTCIMKCSEKFLKHSERVGQRFQEQ
IM09_ORYSA/20-85 MAAMVDQLQIRDSLRMYNSLVERCFTDCVDTFRR-KTLDKQEESCVRRCAEKFLKHSMRVGMRFAEL
IM9A_CAEEL/1-66 MTSEQNIQTFRDFLTQYNLVAEQCFNSCVNEFGS-RTVSGKEESCANNCLDKFLKMTQRVSQRFQEH
Q9Y0V5_CIOIN/6-72 AQKLAAELEVEMMADMYNRMTSSCHKKCISTRYDTGDLEKGEAVCIDRCVAKYLDIHEQIGKKLTEM
Q9Y0V6_CAEEL/6-72 QMAQVAELEVEMMSDMYRRMTNSCQAKCIATAFRESELTKGEAVCLDRCVAKYLDVHEKLGKRLTSM
Q9UTE9_SCHPO/16-82 QNIAMAEQEVEMMSDIFNRLVMTCHKKCISPKYYEADLTKGESVCIDRCVSKYFEANQSLSQHMQKR
IM10_YEAST/17-83 QKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNVQVGENMQKM
IM08_DROME/17-79 FLLIEKQKAQVNAQ--IHEFNEICWEKCIGKPS--TKLDHATETCLSNCVDRFIDTSLLITQRFAQM
IM8B_HUMAN/15-77 LVAAEQQKAQFTAQ--VHHFMELCWDKCVEKPG--NRLDSRTENCLSSCVDRFIDTTLAITSRFAQI
IM8A_HUMAN/20-84 QHFIEVETQKQRFQQLVHQMTELCWEKCMDKPG--PKLDSRAEACFVNCVERFIDTSQFILNRLEQT
IM08_SCHPO/21-85 SKFIESEQQKVKLQQAIHQFTSTCWPKCIGNIG--NKLDKSEEQCLQNCVERFLDCNFHIIKRYALE
IM08_NEUCR/20-86 RGFISNETQRQRVQGQTHALTDSCWKKCVTSPIKTNQLDKTEAVCMADCVERFLDVNLTIMAHVQKI
Q9Y0V8_CAEEL/12-78 LQQLQAETQRQKFTEQVHTLTGRCWDVCFADYRPPSKMDGKTQTCFQNCVNRMIDASNFMVEHLSKM
IM08_ARATH/12-77 LQFLAQEKERAMVNEMVSKMTSVCWDKCITSAPG-SKFSSSESSCLTHCAQRYMDMSMIIMKRFNSQ
IM13_ORYSA/18-82 MDQIKAQLAQAYAQEFLETVGNKCFAXCVTKPG--SSLSGSESSCISRCVDRYIEATGIVSRXLFXS
IM13_ARATH/22-86 MESVKTQLAQAYAEELIETLRTKCFDKCVTKPG--SSLGGSESSCISRCVERYMEATAIISRSLFTQ
IM13_DROME/12-76 MNQVKQQIALANAQEMLSKMTEKCFKKCIQKPG--KSLDSTEQRCISQCMDRFMDAWNLVSRTYGNR
IM13A_RAT/23-87 MEQVKVQIAVANAQELLQRMTDKCFRKCIGKPG--GSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSR
IM13_SCHPO/22-86 MKQIRQELAVAQAGELISKINENCFDKCIPEPG--STFDPNEKSCVSKCMERYMDAWNIVSRTYISR
IM13_BRUMA/22-86 ISGVKQQAAILTAQNMITDXSERCLTKCITXPG--SALSXTERQCLQRCMDRFMETYXLASQXLQNR
IM13_CAEEL/22-86 ISGVKQQAALANAQNLVTDISEKCTNKCITAPG--SSLASGEKQCLQRCMDRFMESWNLVSQTLQKR
IM13_YEAST/34-95 KNQIAQELAVANATELVNKISENCFEKCLTSPY---AT--RNDACIDQCLAKYMRSWNVISKAYISR