EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02943 alignment
(3 sequences with 105 aa)


FTRC_CYACA/6-110 KNLESLHKFAEAYAKLSRTYFCIDQSITALVIEGLARHKDDYGAPLCPCRHYENKKTEVLAAYWNCPCVPMRERKECHCMLFLQPSNEFSGESQLISKDDLQKHL
FTRC_PORPU/11-115 DNLEAMRKFSETYAKRTGTFFCADNSVTAVVIEGLARHKDKYGAPLCPCRHYEDKKAEISATYWNCPCVPMRERKECHCMLFLTPDNEFTSDLQEIDKTTLLEKI
Q55389_SYNY3/10-114 KTLAAMKNFAEQYAKRTDTYFCSDLSVTAVVIEGLARHKEELGSPLCPCRHYEDKEAEVKNTFWNCPCVPMRERKECHCMLFLTPDNDFAGDAQDIPMETLEEVK