EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02939 alignment
(7 sequences with 81 aa)


UCRQ_SCHPO/13-92 WWGHLGGPKQKGIITYSLSPFQQRPMAGFFKTSTQNMFR-RVMTEGLYVAIPFGIAYYIYCWGKERNEFLNSKHGRHLVEE
UCRQ_NEUCR/25-104 GWGNFGGMKQRGIISYGISPNRQNPLAGTAHDAVFNTFR-RVSSQFLYWAPSLVAGYYIMNWAIERNHYLNSKAGRAEFAG
UCRQ_YEAST/12-91 WWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR-RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELER
UCRQ_KLULA/12-91 WWGSIGSPAQKGITTYTVSPYAQKPLNNIFHNAVFNTFR-RVKSQILYMALPAALYWAWWVNCRDYNAYLYTKAGREELER
UCRQ_BOVIN/1-80 GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLR-RTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYEND
Q9VVH5_DROME/9-88 GQHFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVR-RFRSNVFIVTPPFIVGYLIYDLTERKHTALLRKNPADYAND
O45525_CAEEL/9-89 GKHFGNLGKMYGEHRFALAPNEQKAYKGFFDQAFVKTFKTYVWDQWYYYIPQTIGAYLLYDWAKKTNVAANRKNPADFAND