EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02923 alignment
(2 sequences with 169 aa)


Q9RM91_BACSP/1-158 MKVKNVEVLIDKGRN----TQEIESIKAHVLNSIENMQYPANSGAFHLYGGKKAN-GVKPIKDS-YMMHQQEHGWILEYKLDVG-VTNSRPGPIDAVLPVS--D--KYFAVEWETGNIASSHRAINKMIVGMLNGKLIGGILILPSREMYDYLTDRVGNFRELSPYFDV
T2BA_BACAM/1-168 MEVEK-EFITDEAKELLSKDKLIQQAYNEVKTSICSPIWPATSKTFTINNTEKNCNGVVPIKELCYTLLEDTYNWYREKPLDILKLEKKKGGPIDVYKEFIENSELKRVGMEFETGNISSAHRSMNKLLLGLKHGEIDLAIILMPIKQLAYYLTDRVTNFEELEPYFEL