EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02884 alignment
(5 sequences with 84 aa)


O86516_STRCO/665-748 LTVLANDDRRQAVSVPSLGLTAANFWQAGTAGPLTTTAGASVLVRRRGRTATLRVSEPPRTGEALEIVWDHPVGAVLRADETVE
CSLA_PEDHE/600-672 PKVLANTNQLQAVYHQ-----QLDMVQAIFYTAGKLS----VAGIEIETDKPCAVLIKHINGK--QVIWAADPLQKEKTAVLSI
HYSA_STRPN/932-1004 SSLIENNETLQSVYDA-----KQGVWGIVKYDDSVST----ISN-QFQVLKRGVYTIRKEGDE-YKIAYYNPETQESAPDQEVF
HYSA_STRA3/913-984 VELLENSSKQQVIYDK-----NSQTWAVIKHDNQESL----INN-QFKMNKAGLYLVQKVGND-YQNVYYQPQTMTKT-DQLAI
HYSA_STAAU/705-780 VTVVKQEDDFHVVKD------NESVWAGVNYSNSTQTF--DINNTKVEVKAKGMFILKKKDDNTYECSFYNPESTNSASDIESK