EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02831 alignment
(2 sequences with 68 aa)


VG03_ECOL6/1-68 MVTVAELQALRQARLDLLTGKRVVSVQKDGRRIEYTAASLDELNRAINDAESVLGTTRCRRRPLGVRL
VHTJ_LAMBD/1-68 MTRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKKYIAELEVQTGMTQRRRGPAGFYV