EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02821 alignment
(11 sequences with 132 aa)


Q9ZFE2_STREQ/59-187 SKDYQDTTGLYLMINVNGVDSRHNTLVLPQYQDIKLDYNKTYTKDELLRFVQNVIDA.SMENFKVIDLHEVKLVRTATQEEMSPNTFSTLAENQYNDANQSYLLTGNVLVEPVSK--RNLKEVIKTDKAGKP
SAK_STAAU/42-163 AS-YFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDAtAYKEFRVVELDPSAKIEVTYYDK--NKKKEETKSFPITEKGFVVPDLSEHIKNPGFN-------LITKVVIEKK
Q9ZFE3_STREQ/155-279 NPAESVFVDYDIKFMSLSNDAPKPQTLS----LGRKRVGEVISAQELKEKAQELLQK.THPDYTIIDQLETRITHDFAKS--TYFENDNDFNYTIQNRQKIDSNPTKDSYNELKDVNGNRDSISTTYVIVKK
Q57391_STRPY/179-305 NSAERVNVNYEVSFVSETGDLDFTPLLRNQYHLTTLAVGDSLSSQELAAIAQFILSK.KHPDYIITKRDSSIVTHDNDIFR-TILPMDQEFTYHIKDREQAYKANSKTGIEEKTN---NTDLISEKYYVLKK
Q53284_STREQ/153-279 NQAKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNK.THPGYTIYERDSSIVTHDNDIFR-TILPMDQEFTYHVKNREQAYEINKKSGLNEEIN---NTDLISEKYYVLKK
Q9S6V1_STRSP/157-282 HPTETANIEYKVQFATKDGEFHPLPIFVD---YGEKHIGEKLTSDEFRKIAEEKLLQ.SYPDYMIDQKEYTIIKHNSLGQLPRYYSYPDDFSYEIQDRQRIMAKDPKSGKELGET--QSIDNVFEKYLITKK
STRP_STREQ/48-172 VAGTVEGTNQDISLKFFEIDLTSRPAHGG--KTEQGLSPKSKPFATDSGAMSHKLEK.ADLLKAIQEQLIANVHSNDDYFEVIDFASD----ATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPY
Q9ZFE3_STREQ/38-150 QIRQKSNIVITVSGLVKDTNEEFHIKYVD-----LDLNSSILQKEQLLQAINYRIKQ.TFENKKLKAVD---FAKDARLT---DWEEN----LYIANPSNGSVDLGKQGIKEYRL---TGHVILEEVEEAPE
Q9S6V1_STRSP/40-154 PDENKITFAINVDGFVEGSNQEILIRGIH--HVLTDQNQKIVTKAELLDAIRHQMVL.LQLDYSYELVD---FAPDAQLLT---RDRR----LLFANRNFEESVSLEDTIQEYLL----KGHVILRKRVEEP
Q9ZFE3_STREQ/280-394 DRLDSSGNLKKEKVQVKYVDMDTNEVLY---------QQTYHVDGKPSIAFHDGYNR.DTRHNLLSTTLDPYNIYGYSTTG-DITQSRVDDTLVVTVTMFKNPLFQTPYDHYDYV----YH--DGEYYTYEE
Q53284_STREQ/282-399 KPYDPFDRSHLKLFTIKYVDVNTNELLK---------SEQLLTASERNLDFRDLYDP.RDKAKLLYNNLDAFGIMDYTLTG-KVEDNHDDTNRIITVYMGKRPEGENASYHLAYD---KDRYTEEEREVYSY