EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02792 alignment
(3 sequences with 143 aa)


MGN_SCHPO/3-145 DFYVRYYSGHHGRFGHEFLEFDYHSDGLARYANNSNYRNDSLIRKEMFVSELVLKEVQRIVDDSEIIKESDESWPPENKDGKQELEIRMNGKHIMFETCKLGSLADVQNSDDPEGLKVFYYLIQDLKALCFSLISLNFKLRPV
MGN_CAEEL/10-152 DFYVRYYVGHKGKFGHEFLEFEFRPNGSLRYANNSNYKNDTMIRKEATVSESVLSELKRIIEDSEIMQEDDDNWPEPDKIGRQELEILYKNEHISFTTGKIGALADVNNSKDPDGLRSFYYLVQDLKCLVFSLIGLHFKIKPI
MGN_ARATH/8-150 EFYLRYYVGHKGKFGHEFLEFEFREDGKLRYANNSNYKNDTIIRKEVFLTPAVLKECKRIVSESEILKEDDNNWPEPDRVGKQELEIVLGNEHISFATSKIGSLVDCQSSNDPEGLRIFYYLVQDLKCLVFSLISLHFKIKPI