EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02783 alignment
(7 sequences with 186 aa)


Q49601_METKA/3-188 REAKDTVDLYDDRGNCVAEEVPIEVLSPMRNEAIQSIVNDIKRTVAIDLEGIENALQNATVGGKGMKIPGREMDVDIVDNAEAIADEIEKMIRVYEDDDTNVEPMYDGKRLLVQLPSERVKVMADPYSGTLQAGMAVVHAIIDVCEVDMWDANMVKAAVFGRYPQTIDYFGGNVASMLDVPMKQEG
MCRB_METTM/1-186 AKFEDKVDLYDDRGNLVEEQVPLEALSPLRNPAIKSIVQGIKRTVAVNLEGIENALKTAKVGGPACKIMGRELDLDIVGNAESIAAAAKEMIQVTEDDDTNVELLGGGKRALVQVPSARFDVAAEYSAAPLVTATAFVQAIINEFDVSMYDANMVKAAVLGRYPQSVEYMGANIATMLDIPQKLEG
MCRY_METJA/2-187 LHYEDRIDLYDERGKLLEENVPLEAISPLKNPTIEKIVNDIKRSVAINLAGIENALKTGAVGGKACFCPGRELDLPIVENAEIIAEKIKRMVQIEEDDDTVVKLINGGKQLLLQLPSKRLRVAADYTVSALIGGGATVQAIVDAFDVDMFDAPVVKTAVMGRYPQTVDFHGANIATLLGPPVLLEG
MCRY_METTH/1-186 PMYEDRIDLYGADGKLLEEDVPLEAVSPLKNPTIANLVSDVKRSVAVNLAGIEGSLKKAALGGKSNFIPGREVELPIVENAEAIAEKVKRLVQTSEDDDTNIRLINNGQQILVQVPTTRMGVAADYTVSALVTGAAVVQAIIDEFDVDMFDANAVKTAVMGRYPQTVDFTGANLSTLLGPPVLLEG
MCRB_METJA/5-190 VKYKDTINLYDEKGKLVEENVPLEAISPLHNPTIQKLVKDVKRTVAVNLAGIENALRTGQVGGKGCMIKGRELDLPIVENAETIAEYVEKVVRVSEDDDTSIKLINDGKQMAVQIPSKRLDVAAEYSVSVLVTAQALKEAIIRTFDVDIFDAPMVHAAVLGGYPHEVTMKGSNIAALLGSPLSLEG
MCRB_METVO/2-187 VKYEDKICLFDAKGNQVAEDVPLEAISPLNNPTIMGMVKNIKRTVAVNLAGIEESLAKGKIGGKGCQVPGTNIELDVIGDAEAIADKVKSILQVSAGDDTEVKLINGGKQMAEQVPSKRLDVAAEYSVSMLSTGMALKEALITNFNIDMFDGSTVHSAIMGQYPQDMDYAGGNIASLLGAPSKLEG
MCRB_METBA/1-183 ---SDTVDIYDDRGKLLESNVDIMSLAPTRNAAIQSIIMDTKRSVAVNLAGIQGALASGKMGGKGRQILGRGLNYDIVGNADAIAENVKKLVQVDEGDDTNVIKVKGGKSLLIQSPKSRIIAGADFMSATTVGAAAVTQTIMDMFGTDPYDAPIVKSAVWGSYPQTMDLMGGQVQGILSIPQNNEG