EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02760 alignment
(7 sequences with 171 aa)


IFI4_MOUSE/245-415 lHSEPLTVMVLTATDPFEYESPEHEVKNMLHATVATVSQYFHVKVFNINLKEKFTKKNFIIISNYFESKGILEINETSSVLEAAPDQMIEVPNSIIRNANASPKICDIQKGTSGAVFYGVFTLHKKTVNRKNTIYEIKDGSGSIEVVGSGKWHNINCKEGDKLHLFCFHLK
MNDA_HUMAN/208-375 .QNDPVTVVVLKATAPFKYESPENGKSTMFHATVASKTQYFHVKVFDINLKEKFVRKKVITISDYSECKGVMEIKEASSVSDF--NQNFEVPNRIIEIANKTPKISQLYKQASGTMVYGLFMLQKKSVHKKNTIYEIQDNTGSMDVVGSGKWHNIKCEKGDKLRLFCLQLR
IF16_HUMAN/200-370 lQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLR
II2A_MOUSE/57-224 lHEKPMTVMVLTATEPFNYKEG---KENMFHATVATESQYYRVKVFNMDLKEKFTENKFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLR
IFI3_MOUSE/202-369 .HQGPKQVMVLKVTEPFTYDFEE-TKR-MFHATVATETEFFRVKVFDTALMSKFIPGKIIAISHYIGCNGFLEIYRASCVSDVNINPTMIISNTLSESAIATPKISYLLSQAKGTFVNGEFVVFKKSERHECICYGIGDDTGKMAVVVYGRLTNVRCEPGSKLRLVCFELT
AIM2_HUMAN/149-318 fQKRCLPVMVLKAKKPFTFETQE-GKQEMFHATVATEKEFFFVKVFNTLLKDKFIPKRIIIIARYYRHSGFLEVNSASRVLDAESDQKVNVPLNIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTMKCKEGDKVRLTFFTLS
II2A_MOUSE/255-422 yHKGPKQVVALKATKLFTYDSI-KSKK-MFHATVATDTEFFRVMVFEENLEKKFIPGNTIALSDYFGMYGSLAIHEYSSVSEV-KSQNKEDSSSSDERPIEHLKICDLHLQTEERLFDGEFKVYRKSSGNNCICYGIWDDTGAMKVVVSGQLTSVNCEIGNTIRLVCFELT