EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02748 alignment
(9 sequences with 56 aa)


PYRI_METTH/103-154 DEVRG--ILRCPNPNCITNSDEGVEN-RFYVISEEP-VLLRCYYCERLIEADEIES
PYRI_PYRAB/100-150 DVIEG--ILRCGNPNCITNHEYVTT--KFYVISREP-LKVRCHYCERTMEEEEILA
PYRI_METJA/100-148 DEIEG--TLKCTNPNCITNKEKVRG--KFKIESKNP-LKIRCYYCEKFLN--EVIF
PYRI_SULAC/105-156 KVVKG--ILKCPNPYCITSNDVEAI-PTFKTLTEKP-LKMRCEYCETIIDENEIMS
PYRI_ARCFU/99-152 EVVEG--VLKCPNHACISNAEREPITPKFYIKTEEMRATARCHYCGRKIENLDNYI
PYRB_THEMA/473-526 PTIYGFEELRCKNENCITNPAHGENASPSFVRNEKG--QFICEYCETPHSFEEIWS
PYRI_VIBS2/100-151 KEVEN--VFPCPNSNCITHGEPVIS--SFTIKMIKGNIGLKCKYCEKTFSKEIVTA
PYRI_SALTY/100-151 ERINN--VLVCPNSNCISHAEPVSS--SFAVKKRANDIALKCKYCEKEFSHYVVLA
PYRI_SERMA/100-151 DHIDG--VLTCPNGNCISRSEPVRS--SFSVKSRGGEVHLKCRYCEKEFEHQVVLQ