EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02744 alignment
(10 sequences with 221 aa)


GAL7_YEAST/193-365 EVSQE--------LKSFDKYKR--------EHNTDLFADYVKLESREKSRVVVENES------FIVVVPYWAIWPFETLVIS---KKKLASISQFNQMVKEDLASILKQLTIKY---DNLFETSFPYSMG------IHQAPLNATGDELS---NSWFHMHFY-PPLLRSATVRKFLV-GFELLGEPQRDLTSEQAAEKLRNLDG---------QIHYLQRL
GAL7_KLULA/191-363 EPAKE--------FDHFEKYEH--------QHGAHLLEDYVNLELREKERIVCENDS------FLVVVPYWAVWPFETMVLS---KRRIPSLNQFTDKEREDLASIIRNLTIRY---DNLFETSFPYSMG------LHQASLNATEGELK---AAWFHMHFY-PPLLRSATVRKFLV-GFELLGQPQRDLTAEQAADRLKALSG---------EVHYLAKL
GAL7_HAEIN/179-348 EVARE--------DRTQRDYLL--------KHGSVMLVDYVKRELALKERIVVETEH------WIALVPYWAIWPFETLLLP---KTHVKRLTELSDEQSKDLAVILKKLTTKY---DNLFETSFPYSMG------FHAAPFNGEDNE-----HWQLHAHFY-PPLLRSATVRKFMV-GYEMLGENQRDLTAEQAAERLRALS----------EVHYKERT
GAL7_ECOLI/178-347 EAERE--------DRLQKEYFA--------EQKSPMLVDYVQRELADGSRTVVETEH------WLAVVPYWAAWPFETLLLP---KAHVLRITDLTDAQRSDLALALKKLTSRY---DNLFQCSFPYSMG------WHGAPFNGEENQ-----HWQLHAHFY-PPLLRSATVRKFMV-GYEMLAETQRDLTAEQAAERLRAVS----------DIHFRESG
GAL7_HUMAN/198-370 IAQRE--------ERSQQAYKS--------QHGEPLLMEYSRQELLRKERLVLTSEH------WLVLVPFWATWPYQTLLLP---RRHVRRLPELTPAERDDLASIMKKLLTKY---DNLFETSFPYSMG------WHGAPTGSEAGANWN--HWQLHAHYY-PPLLRSATVRKFMV-GYEMLAQAQRDLTPEQAAERLRALP----------EVHYHLGQ
GAL7_CRYNE/200-373 EPATE--------IENFVRYASG-------RSGSHMLLDYALREVKARERVVTLHESG-----WVAVVPYWAAWPFEILLMPY--KRHIPSILQLTAEEQTGLATILKDVLSRY---DNLFSCPFPYSMG------LHQSPLPPTDPTSN---SAQVHFHFY-PPLLRSATVRKFMV-GFELLGEAQRDIVPEQAAVRLRESL-----------PHKRATL
GAL7_STRLI/179-354 RTALM--------LRSLAAHKD--------ATGGGNLFDSVLEEELAGERVVLEGEH------WAAFVAYGAHWPYEVHLYP---KRRVPDLLGLDEAARTEFPKVYLELLRRFDRIFGEGEPPTPYIAA------WHQAPFGQLEFEGVTRDDFALHLNFSLPPYVRQAEVPRGLR--IRHERVHQRDVPPERAAERLREVA----------DVHERE--
GALT_LACHE/223-431 VINQQTLINLVEIEKIFPHYFVGSNADLPIVGGSMLAHEHYQGGRHTFPMMKAGIKKNIMFDSYPKVVAGIVDWPMSDLRLTSDNSLDLIDLGSKIIKFWDNYSDTARDIKAYEG--ETRHHTVTPIMHREGKNFVLDLVLRDNNTSEKYP--LGIFHPHKQ-LWHIKKENIGLIEVMGRAILPGRLKSELEEVKKYWLGED-------NKMAASHKEWAD
GALT_STRMU/227-435 VISQNTFRQLLDIVDIFPGYFAGSNSDLPIVGGSILSHNHYQGGRHIFPMEIAELDSVFRFKDFPDVTAGIVKWPMSVIRLRGANKYSLVELAEIIRLAWRNYSDDTMNILAFTG--DTPHHTVTPIARKRDGQFELDIVLRDNHTTAEYP--DGVYHPHID-VQHIKKENIGLIEVMGLAILPPRLKKELAEVEKYVLNQY-------NEMADYHKDWAD
GALT_BACSU/236-451 EISKKTFERLLSFLGQYPHYFIGSNADLPIVGGTILSHDHFQGGAHDFPMARAEAEDVYELNDYPGVSLGLVKWPMSVLRLQGDEPGHVAEAADHIFRTWQTYSDEKAGIAAYTG--DTPHNTVTPIARRRGDLYELDIVLRNNRTDEEHP--LGIFHPHQE-VHHIKKENIGLIEVMGLAILPGRLQEEMKETAAALCSADPKTALEQNPLTAKHSEWAL