EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02742 alignment
(10 sequences with 73 aa)


MNTR_BACSU/63-133 TSKGKKIGKRLVYRHELLDQFLR-IIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKD-LKSI
O30276_ARCFU/63-134 TEKGVREAMKLREKRNVVIKFLK-AIGVPEDVAERDACTIEHVLHPETLRQLRNFVRFVESSPAVNPRWLEHF
Q50379_MYCSM/65-135 TDKGRALAVAVMRKHRLAERLLVDVIGLPWEDVHAEACRWEHVMSEEVERRLVQVLENPTTSPFGNP--IPGL
DTXR_CORDI/65-135 TPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNP--IPGL
O26316_METTH/68-138 TDRGYRIARRITRKHRLLERFLHDVLGIKRERIHRQACEMEHSLSDDAERALCHLLNMPGECPDEKP--IPAC
P72424_STAEP/63-133 TEEGLKQTLDIIKRHRLLELFLIEILQYNWEEVHQEAEILEHRISDLFVERLDKILNFPKTCPHGGV--IPRG
O33330_MYCTU/72-142 TDSGRRAALAMVRRHRLLETFLVNELGYRWDEVHDEAEVLEHAVSDRLMARIDAKLGFPQRDPHGDP--IPGA
O27019_METTH/72-140 TDEGREIAEMVLRRHMILECFFHNVLGMDLDSSYEEASRMKHELFRETELALMRYLRNPARCPHGIP--IP--
O28295_ARCFU/70-137 NERGKMEARAAVRMHRLIECLLA---DLGVEDFCKEAEKIGMVAGSSLVDALEARYGDREFCPCGKR--IPEV
O28489_ARCFU/62-132 TRKGEELARRIKKYYLALYHFFKDYLGIQDELAEKLSCELEHHITEDAFVRVCRIISGNCEVCESCT--QEYL