EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02718 alignment
(9 sequences with 285 aa)


UL53_HCMVA/29-287 LASKvASTVNGATSANNHGEPPSPADARPRLTLHDLHDIFREHPELELKYLNMMKMAITGKESICLPFNFHSHRQHTCLDISPYGNEQVSRIACTSCED-----------------------NRILPTASDAMVAFINQTSNIMKNRNFYYGFCK-SSELLKLSTNQPPIFQIYYLLHAANHDIVPFMHAE-DGRLHMHVIFENPDVHIPCDCITQMLTAAREDYSVTLNIVRDHVVISVLCHAVSA-SSVKIDVTILQRKIDEMDIPNDVSESFERYKELIQEL
UL31_HHV7J/15-258 LLK-.-------KSKPYNKEK---TNLSLSLSLKELHSVFKLFPEYELKFLNMMKLPITGKEPIKIPFDLSLHHQHTCLDLSPYANEQVSKSACVNCG------------------------TTNIPTASDAMVAYMNQISNVMQNRLYYYGFQK-KVELIRMSAKQPTLFQIFYILSSIASNFLPIMFEN-NEKLNMYVVFQTRTLHIPCECINQIMTVS-SGYTVLLDILHDSIVLHVLCKTIET-SNIQIDINVLQRKIEEMDVPDEIGDKFEKLK-HILPF
UL31_HHV6U/14-263 LSVThR-----IQKRPDHREK---TKLYLQLKLHDLHTVFNLFPEYEQKFLAIIKLPITGKEPIDVPFSLSNHHQHTCLEFSPYANEQISKSACLHCE------------------------SVSVPTSSDAMVAHLNQVNNVMQNRLYFYGFRK-DMELIRMSAKQPTIFQIFYIVHNTINNIFPIMFER-KQKLGMHIVFQSRTLHIPCECIKQIVAVS-SGYNVYLDILQESVILTVLCETLDTNTNIHIDIGMLQKKLEEMDIPNEISDRLEKYKGHLIGF
UL31_SHV21/1-259 MSS-.-RSVK---SRKSTKSRRHHPYVK--LTDKMFFSAISSKKELGTDFLREMDAPICTSKTILLPLDLNSISPGRCIYLSPFGHSSNMEFQCEKCTESKN----KGS------GD-----VSQNHDLYSVTLVFYKNVDKVVKHKAFYLSLLSHSMENLKKSFTQPELLYAYVVVKEAGHNVFPIFFEK-DDCLSICLTFKCQTLHIGESCLRMLMDNL-PNYKISIDYIKDVYAMTFTQCFAIQ-RNISIAEDTICESVSTLDCTDELREEIVKGINALQIK
O40945_HHV8/27-302 LSSR.LRSVPPG-ARSASVSSKHRNGLRKFISDKVFFSILSHRHELGVDFLREMETPICTSKTVMLPLDLSTVAPGRCVSLSPFGHSSNMGFQCALCPSTENPTVAQGSRPQTMVGDA----LKKNNELCSVALAFYHHADKVIQHKTFYLSLLSHSMDVVRQSFLQPGLLYANLVLKTFGHDPLPIFTTN-NGMLTMCILFKTRALHLGETALRLLMDNL-PNYKISADCCRQSYVVKFVPTHPDT-ASIAVQVHTICEAVAALDCTDEMRDDIQKGTALVNAL
Q66672_9GAMA/27-305 RKSLaLRSLNKFHPYKAPSSVRSLKKAHTLVSNGDFFNGISLNCEFGKDFLREMDTPICTSKVICLPLDVHEIAPGRCLVLSPLGHACNMGFYCEKCTQSGQ---NSYSQFQGRGGNAKMAAQNSKDDLHSVTLTFYNQVSKVVQNKNFYLSLLSHSLTTIKKSFVQPSLLYSYTVLRALCDDVFPIFKDT-ENGLCMFALFKTDDLHVSETCLRHLVDNL-IHYRVTLDCVKHTYMLKFSPIRAEA-NGMTIQEVEICEAITGLDFTDEIKQEIISGQELVSEL
O36420_9GAMA/19-278 LKR-.--------KRLNSAKSATLKKKKVFLSNSEFFAGVSTNYELGKDFLREMDTPICTSNTVFLPVKFSDVAPGRCLTLSPYGHSSVLGFHCQECKPDSS------------SGFTQAQQSAESNELLSVNLCFLNNVEKVVQHKAFYLSLLGHSMNTVKQSLGQPSLLYCYTVLKKFYPQIFPIFTAN-GPMLTMYIIFTSLTLHVSEAVLRILTDNV-ENHNLSADCYKGHYILSIEPQALEE-SNLNVCVTKICDLVAQLDFSDELKQEYVNGSTLIANF
O41970_MHV68/23-289 GAMS.IRS-----SRTKHSTAQKGAHRRR-VSLAGFFNLIYKRQDLGLDFLREMSEPLCTSRPVLLPLNLKNIAPGRCISLTPFGHTDNLGFQCETCTDPNLN---------KSIPPKLEDPAFSKNELCSVTLTFYQQAEQVIQHKQFYLSLLNLSMDAVRNSLTQPGLLYCYLVTKAFMLEGFPIFFEETNGMLGLYLVFRRDLLHLHESYLRLLIDNL-GNYDISVDSVGRSYIIKLCPVGNVS-RIPTIPADNVCLAVNNLDYGDDVKASWIECFNIVSRL
UL31_EBV/52-316 RSELgRMERVGSVARSICSRHTRHGVDRSHFSLRDFFRGISANFELGKDFLREMNTPIHVSEAVFLPLSLCTLSPGRCLRLSPFGHSLTLGSHCEICINRSQ--------------------VHVPQEFSSTQLSFFNNVHKIIPNKTFYVSLLSSSPSAVKAGLSQPSLLYAYLVTGHFCGTICPIFSTNGKGRLIMHLLLQGTSLHIPETCLKLLCENIGPTYELAVDLVGDAFCIKVSPRDTVYEKAVNVDEDAIYEAIKDLECGDELRLQIINYTQLILEN