EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02694 alignment
(4 sequences with 109 aa)


Y2672_MYCBO/2-109 VVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGRVLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAP-RG
Y793_SYNY3/2-108 ILRSLLYFVMAGLCEIGGGYLVWLWIREGKSVWLALVRAILLTVYGFVATLQP-ANFGRAYAAYGGIFIILSIIWGWQVDNVVVDRLDWLGAAIALVGVLVMMYAN-RA
YFJF_BACSU/2-109 MLITILLFLAAGLAEIGGGYLVWLWLREAKPAGYGIAGALILIVYGILPTFQSFPSFGRVYAAYGGVFIVLAVLWGWLVDRKTPDLYDWIGAFICLIGVCVILFAP-RG
YNFA_ECOLI/1-108 MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHP-AASGRVYAAYGGVYVCTALMWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT