EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02659 alignment
(6 sequences with 77 aa)


YWLD_BACSU/108-179 LLLFAIGVSLDSF--SVGLSLGIYGSHP---LLTITLFGLFSMMLTWLGLLVGKQVQSWLGTYSEALGGIILIVFGL
Y1812_METTH/103-174 LLVLSIATSIDAF--AVGVSFALLDI---SIWLPVIVIGLITFILSLAGSYIGERVGHIFENRLEALGGLILILIGL
YEBN_ECOLI/108-179 LVTTAIATSLDAM--AVGVGLAFLQV---NIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGV
YWLD_BACSU/12-86 LSIMAFALGMDAF--SVGLGMGMVKLRKKQIFYIGFIIGLFHVIMPLAGMAAGNMLSGLLGVLAVYIGGALLFVLGV
Y1812_METTH/6-82 MVLIGVGLAMDAFSISVSRGLALHESETNYALISALSFGTFQAAMPVLGWVSGLEIQRLVSALAPWAAFILLLIIGL
YEBN_ECOLI/6-82 TVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGMLASRFVLEWNHWIAFVLLIFLGG