EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02609 alignment
(20 sequences with 65 aa)


EX7S_STRCO/15-78 LGYEQARDELIEVVRRLEAGGTTLEESLALWERGEELAEVCRRRLDGARARLD-AALAEEADPED
EX7S_MYCTU/22-85 LGYEACRDELMEVVRLLEQGGLDLDASLRLWERGEQLAKRCEEHLAGARQRVS-DVLAGDEAQNG
EX7S_MYCLE/15-78 LGYEACRDELIEVVRLLEQGGLNLDMSLKLWERGEQLAKRCEEHLDGARQRVA-DVLSARQVEEA
EX7S_CAUCR/14-77 LSFEEALSQLERIVQELESGQAALERSIDIYERGAALKAHCEKKLEAARLKVEKIVLGQGG-AVA
EX7S_RHILO/12-76 MSFEQALDALEKIVDDLERGDVPLDQSIRIYERGEALKAHCDRLLKAAEDKVEKIRLSRDGKPVG
EX7S_ZYMMO/10-74 LSFEEALKKLEEIVRRLESGDTTLEDSIQMYSQGDALKKQCEARLKAAQKKIEQISLDQDGRATG
EX7S_RICPR/13-74 --FEEALRELEEIVKKIDTGQENLETAVNSFERGILLKNHCEKKLKEARLKIEKITKLADS-TVI
EX7S_STAAW/6-69 QSFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAEKKVN-DLIKEEAEDVK
EX7S_THEMA/1-64 MNFEEMMKELEEIVNRLENEDLPLEESIKLFERGVELYRKCKEILQQNRLKII-DVMKELEGEID
EX7S_NEIMA/7-67 KSFEEALSRLESLTQAMQ-GEMPLEDALAAYQEGNELVIYCQTKLAQVEQKL--QVLDADG-LKE
EX7S_STRPY/5-68 KTFEENLQDLETIVNKLENGDVPLEEAISEFQKGMLLSKELQKTLQAAEKTLV-KVMQADGTEVD
EX7S_STRR6/5-68 KKFEENLAELETIVQSLENGEIALEDAITAFQKGMVLSKELQATLDKAEKTLV-KVMQEDGTESD
EX7S_BACSU/1-64 MTFEEAMKGLESIVSKLEEGDVPLEQAINYFQEGMALSKMCHEKLQKVEKQMD-FILKEDGELAP
EX7S_BACHD/9-72 LSFEEAMEQLEEVVEQLEQGDVPLEEAISMFQKGMNLSKVCHEKLATVEKQMD-QILKEDGNFEE
EX7S_XYLFA/13-75 ARFEQSLQELEQLVQNMETGALSLEQSLGAYERGIALYRECHQALEQAQLRVR--LLSDPMHPDD
EX7S_PSEAE/9-69 --FEQSLTELQTLVERLESGELSLEESLGAFEQGIRLTRECQTSLSQAEQKVQ--ILLERDGELS
EX7S_VIBCH/9-71 MSFESTIEELEQLVEQLESGDLALDEALRKFERGISLARAGQLKLDDAEQRVR--ILLSNSDDAP
EX7S_PASMU/11-73 LDFENTLQQLEAIVTRLESGELPLESALEEFERGIKLAHLGQERLQQAEQRIQ--ILLQKSDSAK
EX7S_HAEIN/9-71 QDFETTLVQLENIVTHLENGDLPLEEALKEFEQGVQLAKLGQERLQQAEQRIQ--ILLQKTEDAP
EX7S_ECOLI/8-70 ASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAEQRVQ--ILLSDNEDAS