EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02604 alignment
(84 sequences with 78 aa)


Q83WJ8_ENTFC/1-75 MEAVAYSNF.RQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQE-TLRTLSNNYVMEKIRR.GDEQFSKG
Q8DX48_STRA5/1-75 MEAIVYSHF.RNNLKDYMKKVNDEFEPLIVVNKNPDENIVVLSQDSWESLQE-TIRLMENDYLSHKVIN.GISQVKEK
Q8DNR2_STRR6/14-88 MEAVLYSTF.RNHLKDYMKKVNDEFEPLTVVNKNPDEDIVVLSKSEWDSIQE-TLRIAQNKELSDKVLR.GMAQVRAG
Q7P2Y6_FUSNV/1-74 MIATNYSEV.RNNLKAYCDKATKDYETIIITRKNNE-NVVLMSEEEYNNLME-NLYIRSNLKYYQRLVE.SIKEVEKG
Q7P2C4_FUSNV/1-71 MLAINYTTL.RTNLKSYFDKAVDNDEDIIITRKNER-NVVLLSLDKYNEFLK----AMRNLEYMTKIRE.GIAELEAG
Q9Z5W8_FRANO/1-75 MQTVNYSTF.RNELSDSMDRVTKNHSPMIVTRGSKKEAVVMMSLEDFKAYEE-TAYLMRSMNNYKRLQN.SIDEVESG
Q82WG6_NITEU/16-89 MDAITYSTA.RAKLADTMNRVCDNHEPIIITRNGEQ-SVVMMSLDDFKALEE-TSYLLRSPKNAKRLLE.SIAALESG
Q7N4P2_PHOLL/1-74 MDTINYSAF.RTHFASPLDKVNDNHKPILITHQNGK-PAIALRLEDFQAYEE-TAYLMASPKNAAHLNQ.AIAEVEAG
Q7N6B4_PHOLL/1-74 MRKTIYSVA.KGNLASIMDQVVQDCTPILITRQNGG-DCVIISSAEYASLEE-TAYLLRSSANAKHLLK.SLEQVNSG
YEFM_ECOLI/1-74 MRTISYSEA.RQNLSATMMKAVEDHAPILITRQNGE-ACVLMSLEEYNSLEE-TAYLLRSPANARRLMD.SIDSLKSG
Q7N280_PHOLL/1-74 MKVLTYSEA.KQNLSETMTNVVNDCSPVIITRKNGE-SCILMSLTDVESLQE-TAYLMRSPTNANRLLE.STSQLRTR
Y761_SYNY3/12-85 MNAVSQIIA.QQKLAAIMEQVCSDHVPTIITRDTQP-SVVMISLEDYQSLEE-TAYLLRSPNNAQKLMS.AIKQLEND
Q83AB4_COXBU/1-74 MNVVTFSEL.RAQLKKILDLSADQHEPVVVKRPNKE-TMVILSLRDFEALKE-TAYLLSNEANAARLRQ.SIRSLKQG
Q82UX1_NITEU/17-91 MKVVTYSHA.RNALKSILDDVIQDADVIVISRRDAEGDAVVMSLDSYNSIME-TLHLTSNPANAAALAK.AIAQDKAG
Q8KPS5_SYNP7/17-90 MKVVSFSDA.RKNLKTVLDEVVNDADYTIITRRNAE-EVVVMSLDSFNSLIE-TFHLLKSPANAAHLQR.SIAQYQQG
Q87NP7_VIBPA/16-89 MRIVSFTEA.RNGLKAVLDGVVNDADTTVITRRDSE-DAVVMSLDYYNSLME-TVHLLRSPQNVEHLNR.SIAQYRAG
Q88IQ9_PSEPK/1-74 MHVLTFSQA.RAELKQTMDDVCRDHEPAVITRQRGE-PVVMMSLEDYNGMNE-TIHLLGSSKNASRLRS.SIAQLRDG
Q88AP9_PSESM/1-74 MQVLSFSQA.RAGLKQAMDDVCRDHEPALITRLRGD-HVVMLSLDDYNSMSE-TMYLLGTEANAKHLRQ.SIAQHKAG
Q99RM1_STAAM/1-74 MIIKNYSYA.RQNLKALMTKVNDDSDMVTVTSTDDK-NVVIMSESDYNSMME-TLYLQQNPNNAEHLAQ.SIADLERG
Q8Z0C6_ANASP/19-92 SNTYTYTQA.RDRLSELCDKVTSERDFVVITRRNAE-NVALIPVDELSSLLE-TAHLLRSPRNAERLLR.ALDRAKSG
Q8KRD6_RHOER/1-74 MKTMSYTES.RARYAEVLDGVTNDREEVIITRAGHE-PVVMVSLDDYESLRE-TAHLMRSPANARRLLD.AMERLESG
Y2754_SYNY3/1-74 MKAITTTQA.KDHLDELINAVISDLEPTIVSNNQGQ-QAVLISLDEFNSWQE-TLYLLSNPTNAEHLMA.SIKQAETG
Q8UDV1_AGRT5/1-74 MANVRFTEF.RQNFATHFDRVLETRAPLLVTRQGKE-AVVVLAEGEYESMQE-TLHLLSNPANASRLRA.SMGELERG
P73973_SYNY3/1-74 METINYQQF.SEKLPTLVEKIGNEQEPLCLELPNYL-RAVIISEQDYRSLME-TVYLLSNPVNAEKLLT.TASRSIDQ
Q99RH5_STAAM/1-75 MIITSPTEA.RKDFYQLLKNVNNNHEPIYISGNNAENNAVIIGLEDWKSIQE-TIYLESTGTMDKVRER.EKDNSGTT
Q7U8N8_SYNPX/1-73 MASISVTEA.RKRLFALVDEVADSHTPVEIHGKRS--NAVLVSEDDWRAIQE-TLYLAAIPGMRESIVD.GMATPTSD
Q7PB29_RICSI/1-73 MEIYNTSEA.RSKLYKLIDYVSDVHKPVYIKGKRN--NVVIISEEDYRNMEE-TLYLLSIPNMHKSIIE.GRAEPIAK
O50462_MYCTU/1-74 MAVVPLGEV.RNRLSEYVAEVELTHERITITRHGHP-AAVLISADDLASIEE-TLEVLRTPGASEAIRE.GLADVAAG
O33347_MYCTU/1-74 MRILPISTI.KGKLNEFVDAVSSTQDQITITKNGAP-AAVLVGADEWESLQE-TLYWLAQPGIRESIAE.ADADIASG
Q83DQ1_COXBU/5-78 CRVKPISYL.KSNTAEIVRDISETREPMLITQNGEA-KLVVLDVKSYEEYEE-TLSLLKILSLGQKEIE.KGQFRSAD
Q82WH3_NITEU/5-78 TQIRPISYL.KANAAEVLAYLTENREPLIITQNGEA-KAVIQDIASFEETQE-TLALLKILALGNAEIE.AGEVQPVH
Q7MYT0_PHOLL/5-78 EQIKPISYL.KANAATVMTTLAESRSPMIITQNGEA-KAVIQDIASYEQTQE-TIALLKILALGQQQVK.AGEVTPVK
Q8GNE6_9PROT/6-79 QDIKPISYL.KSNTAQVVSSATETQRAIYITQNGEA-KVVIQDIKSFENTQN-TLTLLKLIVQSENEIN.ENKVIEQE
Q9RIC5_YERPE/1-69 MKIETISYV.KKNAASL-----DLEEPILVTQNGV--PAYVIESYDAQQERQNAIALLKLLTLSEQDKA.DGNIFSKE
Q8PR83_XANAC/1-74 MRTELVTTL.KRQATELLAAAERDKEPILITQHGLP-SAYLVDVASYERMQQ-RIALLEGIARGEMAVA.EGRTLSHE
Q8CLX8_VIBVU/1-74 MKVELVTSL.KRQATKILADLHDTKEPVLITEHGKP-SAYLVDVDDYEFMQN-RLAILEGIARGERALA.DGKVVSHD
Q82UB6_NITEU/11-78 EDVIPLADL.KVNPGRVVSRVKETRRPVLLTSRGRG-VAVVQDLDEYEKSQE-------ELAFVKAVAQ.GLMDIKEG
O70047_9ZZZZ/7-74 EDVIPLSDL.KINPGKVVNRTQDTQRPILLTSRGRG-VAVVQGLEDYERAAE-------ELRFVKAVAQ.GLVDVREG
Q8D9P8_VIBVU/8-81 QDIQPLSEF.RAGVTSFIKQINETRRPLVITQRGKG-VAVVLDVAEYEAMQE-KIELLEEMRTAEAQLA.SGLGVSNE
Q82T18_NITEU/1-65 MKAITAKDA.KNKFGEMLDTAQ--REPLTIEKHGRA-VAVIMSVQEYQQMKLERLRA--------KLAA.GEEQLDRG
Q7N9R2_PHOLL/1-68 MEIIPAQLA.KNQFGDLLMKVQ--REPVEISKHGKR-VAVVISPEEYDQFAQLKLQNLKA-----VLAE.SIAQADRG
Q7N5Y7_PHOLL/1-68 MYELSANEV.KTHFGDMLLRAQ--RAPIQINKNGKL-VAVVLSIDEYENIEALKIQLLKS-----RAIQ.TKADIEEG
Q8E847_SHEON/1-68 MNTLSANEA.KIHFGDLLLKAQ--QSPIQINKNGKP-VAVVISADEYQSIEALKLHLLQS-----KAVK.AMTDIQTG
Q7DCR7_VIBCH/1-68 MHTLTANDA.KRNFGELLLSAQ--REPVIISKNSKN-TVVVMSIKDFEELEAMKLDYLKH-----CFES.AQKDLDSG
Q9X102_THEMA/6-78 VSFYSLADA.KARFSQVVEEAKTKD--VVVTKNGVP-AVAVIDYEKYKKLMEFMDEILDTYLLDIGNVE.KYLELKRY
Q9FCD0_STRCO/2-76 AYEIPVTQA.RAELADLINRVVYGGERVVVTRHGKP-LVALVSAADLARLEELRESPDAQVIASVAGVH.DASAASAP
Q826S3_STRAW/2-76 AYEIPVTQA.RAELADLINRVVYGGERVVVTRHGKP-LVALVSAADLERLDKLDAAEEQVVSAVSSVRE.VAAAPRER
Q8Y2S1_RALSO/6-78 RDVIPLSQA.RANLSELAEQVKAGAEKIVTKNGES--YIALIDAQRLDYYHQLERARIHLLVLDEASK-.GLADVEAG
Q8PLK8_XANAC/10-84 LEKSPAADIkVKGWPSLMRKVRSHGAVVITNHNHP--EAVVVDAEEYRRLVNQASAAAATSARAQSLQA.LQAKFDAH
Q9ZH43_MORMO/8-81 TTAASITDL.KKNPMGTVAEGE--GDAVAILNRNEP-AFYCVPPKLYAYYRELAEDAELNAVADERMKNpEIVKVNLD
Q8ZPF8_SALTY/8-80 TTAASITEL.KRDPMGTFNAGD--GAPVAILNRNEP-AFYCVPPALYAHLMDILEDEELGRIIDERANE.RVIEVNID
Q8GEI6_ERWPY/8-80 NTAASITDL.KRDPMGTVRAAE--GETIAILNRNEP-AFYCVPPAMYAYLMELAEDAELGCIVDDRMSE.LPVAKEIS
Q82UB1_NITEU/8-80 EIAASISEL.KANPMKVVASGK--GMPIAVLNHNEP-AFYCVPAAAYEAMMELLDDIELLKIVKERMDE.PSVKVSLD
Q08800_VIBCH/8-80 DVAASITEF.KANPMKVATSAF--GAPVAVLNRNEP-AFYCVPASTYEIMMDKLEDLELLAIAKERLSE.DSVSVNID
Q7N4Q7_PHOLL/8-80 DISASISEL.KKNPMATLSAGA--GYPIAILNRNQP-VFYCIPAELYEQILDALDDQELIRLVNERRGQ.ALVDVDLD
Q60256_9ZZZZ/8-80 DTSASVSEL.KKNPMATVSAGD--GFPVAILNRNQP-AFYCVPAELYEKMLDALDDQELVKLVAERSNQ.PLHDVDLD
Q82UD0_NITEU/7-79 SFSASISEL.KKNPTALLRKAE--GETIAILNHNLP-TAYLVPAEVYELLMEKLEDYELGEIVKARQAE.KHLAIEVS
Q9KMA1_VIBCH/14-86 NCSASISEL.KKNPTALLNEAD--GSAIAILNHNKP-AAYLVPAETYEYLIDMLDDYELSQIVDSRRAD.LAQAVEVN
Q88JZ5_PSEPK/7-79 EAAVSISEL.KKNPSRILAEAA--GAPVALLDQDRV-MAYLVPAELYEQILERLDDFELAALAKALAAE.KSIRVSLE
YAFN_ECOLI/7-76 EKSVNITEL.RKNPAKYFI-----DQPVAVLSNNRP-AGYLLSASAFEALMDMLAEQEEKKPIKARFRP.SAARLEEI
Q8RBG2_THETN/22-97 SYMISVSDLgRGKASKIIEKVAKKKEHYIVVKNNKP-QAVIIPIEEYDELIEAQEDLELLQLAIERTKN.LKEGETLP
Q82VL3_NITEU/3-76 ITTLSSREL.NQDIGRAKRAARNGPVIITDRGKP---VHVLLSYDEYQRIIGQQENIVDQLGLPSGIEDvEVEFPRSR
Q8KL67_RHIET/5-75 SETYSTSDL.SRKSGDIIAEALRHPVTITQRNKP---RLVLLNIEDYQQLIRQADR--RTVGTIETMPD.ELFAELEN
Y4EA_RHISN/5-75 GGSYSTSDL.SRKSGDIIAEALRHPVTITQRNKP---RLVLLNIDDYERLMRQYDA--RSVGTLETLPG.ELLNEFEA
Q8YUZ9_ANASP/1-76 MKKVTLTEL.SNNIEHLLDEVVETGIPIEINKNGKLFKIVPVEKTDKLKNLIFKPDVIQGNPDDLVNIS.WEQEINID
Q8RAX6_THETN/1-75 MMQVSSTEF.KNNVGKFLKLSEKEDILILKNGKPVA-KLTAVSKNEKEIAYDRLLEMIKKSKPVTEEID.LKAAREER
Q82T22_NITEU/1-74 MHVWPVQDA.KARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAARP--SLKQLLLSDSART.EMLVPERG
Q7NI03_GLOVI/2-75 QSTWQLQEA.KNQFSKVVDLAVTVGPQIVTRHGEPVAVILSVAQYRKLTVPRQS--LVDFLRSSPLVGA.QIDLRRTE
Q89SG5_BRAJA/14-86 DDTWTLANA.KARLSQVIDRAQTG-PQIITRHGKPNAVIVSAEEWARKTARKGT--LAEFLLASPLRGA.DLALERMH
Q8Y121_RALSO/1-74 MQSWQMQAA.KARFSDVVKRAADDGPQEITVHGRPVAVVISRALFDRLSGSGES--LVSFMRQSPLADQ.DDVVFERE
Q7PA58_RICSI/1-74 MNKWQLHEA.KNKLSNIIDIAMHGTPQCITKRGEE--AVVIISIKDYKQLTKQKPDFKEYLLSIPKTDN.LDIQRAKG
Q9AH45_NEIME/1-74 MFQANIHQA.KTNLSQLIQRAEAGEIVIIAKAGKPCVQLTGIEKPARNAGRLKK--FSHMENTDISRIL.EDDNETAA
Q87UE9_PSESM/1-69 MQTHNIHAA.KTHFSQLVDAAAGGETIIIAKAGIPVAKLVPISAPKRRGMLSHV--MFDAEASDAM---.--DAEITE
Q92K09_RHIME/1-70 M-QVTIRNP.KTNLSKLIEAAKAGEEVVIAKGTVPVARVVALPQNKFTIGLTAA--LERWQNKGLDFR-.--GSVKAG
Q92SQ5_RHIME/1-72 MDAVNLADA.KAHLSELVDRVEAGDSIEITRRGKPVARLTAVARPRK----RIDAALLQSLTATMPLQS.GSAADLVR
Q7NMY2_GLOVI/2-76 IFTVGAFEA.KTHFANLLERVARGEQIVITRHGTPVARLVPISGNDRERAKQTIT-RLKEFSRGQTLEG.LSIRALRE
Q7NK01_GLOVI/1-75 MITVGAFEA.KTHLSALLDRVERGEVVVITRHGKPVAQLIAAGATERSNVEQTIA-KLKALRKGSSLAP.FSWKELRD
Y3441_MYCBO/8-83 VEAIGIREL.RQHASRYLARVEAGEELGVTNKGRLVARLIPVQAAERSREALIESGVLIPARRPQNLLD.VTAEPARG
P96916_MYCTU/1-74 MSEVASREL.RNDTAGVLRRVRAGEDVTITVSGRPVAVLTPVRPRRRRWLSKTE--FLSRLRGAQADPG.LRNDLAVL
O07782_MYCTU/2-74 SATIPARDL.RNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRRRQ---WLPAAEVIGELVRLGPDTT.NLGEELRE
O50412_MYCTU/12-84 MTSVGVRAL.RQRASELLRRVEAGETIEITDRGRPVALLSPLPQGGPYEQLLASGEIERATLDVVDL--.-PEPLDLD
Q92JV5_RHIME/2-77 EEAVSAADA.NRKFSLILRSVREGHSYVVTSHGRPVARIVPAAKSDNAVSGARTALLSRLERQPAVIAG.RWTRDELY
Q8R721_THETN/2-77 EKVIGIDKL.RPKLGEYLKEVEKGDVIIVSSRSEPKGVLISYSMYNQLKEFEKKAKQLEIMQILNEFRD.KAEKAGLS
Q8F586_LEPIN/1-76 MKSIGIKDL.KNNLSSYLEFVKKGETIIIYDRNNPIAEIKKILKTDNRTDLYIKEATENNSLIPAKKFK.EIKFPKVK