EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02603 alignment
(4 sequences with 129 aa)


HPRK_TREPA/2-127 LKLDLKE-RDSLD--LRCIAGHHGLANPITISDLNRPGLVLSGFFDFVAYRRIQLFGRGEHAYLLALLEQGRYGAIEKMFTFDLPCCIFSHGITPPEKFLHLAEPSSCPILVTRLTSSELSLRLMRVLS
HPRK_MYCPN/2-129 KKLLVKELIEQFQDCVNLIDGHTNTSNVIRVPGLKRVVFEMLGLFS-SQIGSVAILGKREFGFLSQKTLVEQQQILHNLLKLNPPAIILTKSFTDPTVLLQVNQTYQVPILKTDFFSTELSFTVETYIN
HPRK_MYCGE/2-129 KHLTVKALVLQFNDCIQLIDGKNNIDNVITIPGLKRSVFELLGLFC-KPIGSVAILGKREFIFLNQKPVEQQKKIIANLLKLKPPAVILTKSFLDCGVLLAVNQTYQVPILKTNLFSTELSFTVETYIN
HPRK_BACSU/1-127 AKVRTKDVMEQFN--LELISGEEGINRPITMSDLSRPGIEIAGYFTYYPRERVQLLGKTELSFFEQLPEEEKKQRMDSLCTDVTPAIILSRDMPIPQELIDASEKNGVPVLRSPLKTTRLSSRLTNFLE