EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02589 alignment
(3 sequences with 141 aa)


Q9ZMU3_HELPJ/83-211 NLNFEAFKDFTLQPYDKEI-------EAMREELFEIDTAL-LHGVCGISSLGMIGAVSS---HASPRLLSLITLNCIILLKKESIVRNLSEGVQALKNQGQNGA-LPTNMLLIGGPSRTADIELKTVFGVHGPQKVAVILY
O32259_BACSU/97-237 RFEEYGLKSLLTKDWPSEGTPVWEWDADKGEENIKKAEQANVGITFSEITLAESGTVVLFSSKDIGRSVSLLPTTYIAIVPKSSIVPRMTQASDIIRQNIANGVTVPSCINYITGPSNSADIEMDLVVGVHGPVKAAYILV
O29448_ARCFU/1-120 MKIVEALKANGVEVIITEK-------ADVLIKNFEN-----AHISYALSADEKTGVIFFG--GFEEKMKAGLAEHHVAILKEEDVKENILLAYEHARRKS-------DVLFASSSASKTADIEGKTVFGMHGPRKFTVVLV