EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02562 alignment
(6 sequences with 207 aa)


O67366_AQUAE/121-325 AIVPKTETQKKYVEAIKKNDIVFGIGPAGTGKTYLAMAMALQHLKEGKVNKIILTRPAVEAGEKLGFLPGTIAEKVHPYLTPLYDALYDMVDYDKANYML--ERNIIEIAPLAFMRGRTLNDAFIILDEAQNATRDQMKMFLTRIGFGSKAVITGDVTQIDLPKKKESGLIEAMEVLKNIEGIEFIFFKQTDVVRHPIVAKIINAYE
PHOL_BACSU/112-316 SIRVKTMGQREYVAAMKRNDLVFGIGPAGTGKTYLAVVKAVHALKNGHIKKIILTRPAVEAGESLGFLPGDLKEKVDPYLRPLYDALHDVLGADHTERLM--ERGIIEIAPLAYMRGRTLDDAYVILDEAQNTTPAQMKMFLTRLGFSSKMIITGDVSQIDLPKGVKSGLAVAKEMLKGIDGISMIELDQTDVVRHPLVAKIIEAYD
PHOL_MYCTU/125-329 TIRPKTLNQKRYVDAIDANTIVFGIGPAGTGKTYLAMAKAVHALQTKQVTRIILTRPAVEAGERLGFLPGTLSEKIDPYLRPLYDALYDMMDPELIPKLM--SAGVIEVAPLAYMRGRTLNDAFIVLDEAQNTTAEQMKMFLTRLGFGSKVVVTGDVTQIDLPGGARSGLRAAVDILEDIDDIHIAELTSVDVVRHRLVSEIVDAYA
PHOL_ECOLI/130-334 VIKPRTPNQAQYIANILDHDITFGVGPAGTGKTYLAVAAAVDALERQEIRRILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFEMLGFEKVEKLI--ERNVIEVAPLAYMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNSKAVITGDVTQIDLPRNTKSGLRHAIEVLADVEEISFNFFHSEDVVRHPVVARIVNAYE
PHOL_SYNY3/110-314 IVRAKTFRQRQYIKAIQKHDVTFCIGPAGTGKTFLAAVLAVQALLNNECDRLILTRPAVEAGEKLGFLPGDLQQKVDPFLRPLYDALYEFIEPEKIPDLM--ERGKIEVAPLAYMRGRTLTNAFVIVDEAQNTTPAQLKMVLTRLGFGSKMIVTGDITQTDLPNYQKSGLQVAQTILKDVEGVAFCYLNQADVVRHPLVQRIVEAYE
PHOH_ECOLI/148-354 PILARNEAQLHYLKAIESKQLIFATGEAGCGKTWISAAKAAEALIHKDVDRIIVTRPVLQADEDLGFLPGDIAEKFAPYFRPVYDVLVRRLGASFMQYCLRPEIGKVEIAPFAYMRGRTFENAVVILDEAQNVTAAQMKMFLTRLGENVTVIVNGDITQCDLPRGVCSGLSDALERFEEDEMVGIVRFGKEDCVRSALCQRTLHAYS