EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02556 alignment
(4 sequences with 158 aa)


SECB_RICPR/1-152 MSTINTDTS---EAMPHISVNAQYIKDLSLENPSAPSSLAALDQRPQIDLSLDINITNLSE-ENFYEVELNIEAIARNE--KYKLFQIELKYAGVFNLINIDSEQHPILLSVHCPAMIFPFARKIIASCTQDAGFQPLMIDPIDFGALYHKKMSEHQN
SECB_HAEIN/1-155 MSEQKQDVAATEEQQPVLQIQRIYVKDVSFEAPNLP-HIFQQEWKPKLGFDLSTETTQVG--DDLYEVVLNISVETTLEDSGDVAFICEVKQAGVFTISGLEDVQMAHCLTSQCPNMLFPYARELVSNLVNRGTFPALNLSPVNFDALFVEYMNRQQA
SECB_ECOLI/1-146 MSEQNN-------TEMTFQIQRIYTKDISFEAPNAP-HVFQKDWQPEVKLDLDTASSQLA--DDVYEVVLRVTVTASLG--EETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAG
Y357_METJA/1-143 MEAPPK---------CALKFSNYIVKHIEFILNEVP----EKDEKIRLNVNIDTEIRYNKNEPNKFITIIKITAGEKKD-FAKSPVYLSVEVWGFFEVIEEAIDKVRQFAEINSVAILFPYVRALISTITANANIPPVILPPINVAGMMAN-IEEVKE