EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02548 alignment
(8 sequences with 268 aa)


PANB_AQUAE/1-261 MAINLQTLFKKKREGKKITMVSTYDYWSAKLCDEVGIDCILVGDSLGTVVKGEGDTLSVTLEEIIYHTKCVMRGVKNAFVIADMPFMSYQVSMEKAVENCGRVIKE-TKAKAVKLEGGE-----EIAELVYKLTRIGIPVVGHVGFTPQHINVFGKPKVVG-KKKEEEEKLRRDFRALEEAGAFMIVLESVPTHLAKELWKGSNSIVIGIGAGKYVDGQVLVFHDIVGLFEDFKPKFVRRYLEGAKLVKEALKNFKIDVEGGNFPSEE
PANB_PYRHO/2-259 REITPKRIREMKGK-EKITMITAYDYPSALLADKAGFDIVFIGDSLGMVVYGEPSTLNVTMEQMIFHTRAVAKAVKRALVLADMPFGSYEVSVEEGIKNAIKLVQA-G-ADAVKIEGGY-----DHRKLVKKLVRIGIPVMGHTGLTPQRYLRLGGYRIMG-GTEEEVEEILRDAKALEKAGAFAIVLEFVLADVAKLVTEEVSIPTIGIGSGPYVDGQVLVWHDVLGLYESSPP-FAKRYANLKEEILRAISTFREEVKEGKFPGRE
PANB_HELPJ/9-266 KKITLSHLQAKKNQ-EKIIAITAYDALFAQIFDPL-VDVILVGDSLNMSFFNQNDTLSASVKMMLYHTKAVCAGAKTPFIITDMPFGSYKD-EKTALKNAIRVYKE-TQASAIKLEGGK-----EKAKLVKTLTDEGVIVVGHIGLMPQFVRLDGGYKIKG-KNEEQQKKLLEDALSLEEAGVGLLVLEGITTPIAQTITQKIKIPTIGIGSGKDCDGQILVWSDMLGFFDSFKPKFVREYLKGKELIQNAIQQYADDVKKGNFPNEL
PANB_MYCTU/19-278 TKIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLVRGVVRGAPHALVVADLPFGSYEAGPTAALAAATRFLKD-GGAHAVKLEGGE-----RVAEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQG-RGDA-AEQTIADAIAVAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDGQVLVWQDMAGFSGAKTARFVKRYADVGGELRRAAMQYAQEVAGGVFPADE
PANB_SYNY3/1-260 MAITPTQLLDWKRQQRPIVALTAWDTAIASVLDAAGVEIILVGDSLGMVALGYETTLPVSLDTMIHHTAAVKRGVQRALVVCDLPFLTYQESPAQAMGSAGRVLQE-TGAQAVKLEGGHP----RMVETVARLTEVGIPVMGHVGLTPQSVHQLG-YRQQG-QDPATAEKILHQAIALAEAGVFAIVLEHIPSELAASITEQLPIPTIGIGAGPQCDGQVLVTADLLGLT-VKQPPFAPAYLNLRHTITETVHKFSGEVRQRQFPRRG
PANB_ECOLI/2-260 KPTTISLLQKYKQEKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTAAVRRGAPNCLLLADLPFMAYAT-PEQAFENAATVMRA-G-ANMVKIEGGE-----WLVETVQMLTERAVPVCGHLGLTPQSVNIFGGYKVQG-RGDEAGDQLLSDALALEAAGAQLLVLECVPVELAKRITEALAIPVIGIGAGNVTDGQILVMHDAFGITGGHIPKFAKNFLAETGDIRAAVRQYMAEVESGVYPGEE
PANB_BACSU/1-260 MKTKLDFLKMKESE-EPIVMLTAYDYPAAKLAEQAGVDMILVGDSLGMVVLGLDSTVGVTVADMIHHTKAVKRGAPNTFIVTDMPFMSYHLSKEDTLKNAAAIVQE-SGADALKLEGGE-----GVFESIRALTLGGIPVVSHLGLTPQSVGVLGGYKVQG-KDEQSAKKLIEDSIKCEEAGAMMLVLECVPAELTAKIAETLSIPVIGIGAGVKADGQVLVYHDIIGHGVERTPKFVKQYTRIDETIETAISGYVQDVRHRAFPEQK
PANB_YEAST/24-291 KYNTIQDIRNKYFTGTPLSMCTAYDFITATWVNKANCDLLLVGDSLAMTSLGYDSTITLSLNEFKYHVASVCRAEGSSMVVVDMPFGTFESGISDGLKNAIDIMKLDSKVTSVKVEVGSYTKDKYAMKFIEELCSRGIPVMAHIGLTPQKVHSLGGYKVQGSKSLLQMQELYETAMQLQKIGCWSILIECVPHKMAQFITSKLSVPTIGIGAGNGTSGQVLVISDLLGMQGDSVPKFVKQAVNMTDIATQGLKEYIASVEDRTFPERG