EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02499 alignment
(10 sequences with 374 aa)


VTER_VZVD/382-746 LNQTNCKIIFVSSTNTGKASTSFLYNLRGSSDQLLNVVTYVCDDHMPRVLAHSDVTACSCYVLNKPVFITMDGAMRRTADLFMADSFVQEIVGGRKQnsgGVGFDRP--LFTKTARERFILYRPSTVA--NCAILSSVLYVYVDPAFTSNTRASGTGVAIVGRYKSD---WIIFGLEHFFLRALTGTSSSEIGRCVTQCLGHILALHPNTFTNVHVSIEGNSSQDSAVAISLAIAQQFAVLEKGNVLSSAP.-VLLFYHSIPPGCSVAYPFFLLQKQKTPAVDYFVKRFNSGNIIASQELVSLTVKLGVDPVEYLCKQLDNLTEVIKGgmgNLDTKTYTGKgTTGTMSDDLMVALIMSVYIGSSCIPDSVFMPI
Q65567_9ALPH/371-728 LNQASCKIIFVSSTNTGKASTSFLYNLKGASDGLLNVVTYICNEHTPRVAAHGGATACSCYVLNKPVFITMDAAARNTAETFLPNSFMQEIIGGGEV...-ARRAEPAAVFTRAAGEQFLLYRPSTAA--ARGPWPERLYMYIDPAFTSNARASGSGIAVVGRHRGS---WLVLGLEHFFLPALTGSSAAEIARCAVRCFAQVMAVHRRRLDGLFVAVEGNSSQDSAVAIALGVRRELDSLAASGAVPMPA.-ETRFYHCRPPGSAVAYPFFLLQKQKTAAFDHFIRLFNSGRVVASQDLASLTVRLQTDPVEYLFEQLQNLTESTAG...PGGARAFSGK.-RRGAADDLMVALVMAVFVGSLPPTDGAFCPL
VTER_HHV11/373-731 LNQANCKIIFVSSTNTGKASTSFLYNLRGAADELLNVVTYICDDHMPRVVTHTNATACSCYILNKPVFITMDGAVRRTADLFLADSFMQEIIGGQAR...ETGDDRP--VLTKSAGERFLLYRPSTTT--NSGLMAPDLYVYVDPAFTANTRASGTGVAVVGRYRDD---YIIFALEHFFLRALTGSAPADIARCVVHSLTQVLALHPGAFRGVRVAVEGNSSQDSAVAIATHVHTEMHRLLASEGADAGSgPELLFYHCEPPGSAVLYPFFLLNKQKTPAFEHFIKKFNSGGVMASQEIVSATVRLQTDPVEYLLEQLNNLTETVSP...NTDVRTYSGK.-RNGASDDLMVAVIMAIYLAAQAGPPHTFAPI
VTER_HCMVA/326-674 LAQNTTKIIFISSTNTTSDSTCFLTRLNNAPFDMLNVVSYVCEEHLHSFTEKGDATACPCYRLHKPTFISLNSQVRKTANMFMPGAFMDEIIGGTNK...ISQNT--VLIT-DQSREEFDILRYSTLNTNAYDYFGKTLYVYLDPAFTTNRKASGTGVAAVGAYRHQ---FLIYGLEHFFLRDLSESSEVAIAECAAHMIISVLSLHP-YLDELRIAVEGNTNQAAAVRIACLIRQSVQSSTL--------.IRVLFYHTPDQN-HIEQPFYLMGRDKALAVEQFISRFNSGYIKASQELVSYTIKLSHDPIEYLLEQIQNLHRVTLA...EGTTARYSAK.RQNRISDDLIIAVIMATYLCDDIHA-IRFRVS
VTER_SHV21/333-680 MLQKDAKLIFISSVNSGDRATSFLFNLKNASEKMLNIVNYICPDHKDDFSLQDSLISCPCYKLYIPTYITIDETIKNTTNLFLDGAFTTELMGDMSG...ISKSN-MHKVISEMAITQFDLCRADTTKPEITQCLNSTMYIYIDPAYTNNSEASGTGIGAILTFKNNSSKCIIVGMEHYFLKDLTGTATYQIASCACSLIRASLVLYP-HIQCVHVAVEGNSSQDSAVAISTLINECSP------------.IKVYFIHYKDKTTTMQWPIYMLGAEKSIAFESFIYAINSGTISASQSIISNTIKLSFDPISYLIEQIRSIRCYPLR...DGSHT-YCAK.KRT-VSDDVLVAVVMAYFFATSNK--HIFKPL
Q66632_9GAMA/1-348 MLQKDAKIIFISSVNSSDQTTSFLYNLKNAKEKMLNVVNYVCPQHREDFSLQESVVSCPCYRLHIPTYIAIDENIKDTTNLFMEGAFTTELMGDGAA...ATTQTNMHKVVGEPALVQFDLCRVDTGSPEAQRGLNPTLFLYVDPAYTNNTEASGTGMGAVVSMKNS-DRCVVVGVEHFFLKELTGASSLQIASCAAALIRSLATLHP-FVREAHVAIEGNSSQDSAVAIATLLHERSP------------.LPVKFLHHADKATGVQWPMYILGAEKARAFETFIYALNSNTLSCGQAIVSNTIKLSFDPVAYLIEQIRAIKCYPLK...DGTVS-YCAK.HKG-GSDDTLVAVVMAHYFATSDR--HVFKNH
O40928_HHV8/337-684 MLQKDAKLIFISSVNSSDRSTSFLLNLRNAQEKMLNVVSYVCADHREDFHLQDALVSCPCYRLHIPTYITIDESIKTTTNLFMEGAFDTELMGEGAA...SSNAT-LYRVVGDAALTQFDMCRVDTTAQQVQKCLGKQLFVYIDPAYTNNTEASGTGVGAVVTSTQTPTRSLILGMEHFFLRDLTGAAAYEIASCACTMIKAIAVLHP-TIERVNAAVEGNSSQDSGVAIATVLNEICP------------.LPIHFLHYTDKSSALQWPIYMLGGEKSSAFETFIYALNSGTLSASQTVVSNTIKISFDPVTYLVEQVRAIKCVPLR...DGGQS-YSAK.QKH-MSDDLLVAVVMAHFMATDDR--HMYKPI
VTER_EBV/342-689 MLQKDAKIIFISSVNSADQATSFLYKLKDAQERLLNVVSYVCQEHRQDFDMQDSMVSCPCFRLHIPSYITMDSNIRATTNLFLDGAFSTELMGDTSS...LSQGS-LSRTVRDDAINQLELCRVDTLNPRVAGRLASSLYVYVDPAYTNNTSASGTGIAAVTHDRADPNRVIVLGLEHFFLKDLTGDAALQIATCVVALVSSIVTLHP-HLEEVKVAVEGNSSQDSAVAIASIIGESCP------------.LPCAFVHTKDKTSSLQWPMYLLTNEKSKAFERLIYAVNTASLSASQVTVSNTIQLSFDPVLYLISQIRAIKPIPLR...DGTYT-YTGK.QRN-LSDDVLVALVMAHFLATTQK--HTFKKV
O36378_9GAMA/336-680 MLQKDAKIIFISSSNSSDQSTSFLYNLKGASERMLNVVSYVCSNHKEDFSMQDGLISCPCYSLHVPSYISIDEQIKTTTNLFLDGVFDTELMGDSSC...GTLST--FQIISESALSQFELCRIDTASPQVQAHLNSTVHMYIDPAFTNNLDASGTGISVIGRLGAK--TKVILGCEHFFLQKLTGTAALQIASCATSLLRSVVIIHP-MIKCAQITIEGNSSQDSAVAIANFIDECAP------------.IPVTFYHQSDKTKGVLCPLYLLGQEKAVAFESFIYAMNLGLCKASQLIVSHTIKLSFDPVTYLLEQVRAIKCQSLR...DGSHT-YHAK.QKN-LSDDLLVSVVMSLYLSSANT--LPFKPL
O41945_MHV68/1-345 MLQKDAKIFFISSVNSGEKTTSFLYNLKDANEKMVNVVSYVCSEHMEDFNKQSAITACPCYRLYVPEFITINDNIKCTTNLLLEGSFATELMGNMQS...HTEVS-GNSMIHESSLTRLDFYRCDTAG-QGAPTTENTLFVYIDPAYGNNVHASGTGIVAMSHCKHT-KKCIILGLEHFFLNNLTGTAAHNIASCATALLEGILFQHP-WIQEIRCIIEGNSNQDSAVAIATFISHNIK------------.LPTLFASYRDKT-GMQWPIYMLSGDKTLAFQNFISSLNQGLLCASQTVVSNTVLLSSDPISYLIEQIKNTKCIYHK...NKTIT-FQSK.THT-MSDDVLIACVMTCYVMTTNK--ISYISF