EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02447 alignment
(12 sequences with 467 aa)


YJHF_ECOLI/1-448 MPLIIVVAG-IALLLLLTIKIKLNTFVSLIIVSIAVAIASGMDLSKVVTSVESGLGGTLGHIGLIFGFGVMLGRLLADAGGAQRIALTMLNYFGKNKLDWAVVCSAFIVGIALFFEVGLILLVPILFAIAREAKISPMFMCVPMLSGLLVAHGFLPPHPGPTVIAREYGADVGLVLIYGIIVG-IPTFIL---CGPVLNK---FCQRIIPDAFKKEGNIASLGATRRFSESEMPGFGISFLTAMLPVILMAVVTIIQMTHAKSAADSGLF.YNVILFLGNSTIAMLISLLFAIYTMGLGRGKTIPDLMDSCGKAIAGIAGLLLIIGGGGAFKQVLIDSGVGQYISTLVSGMDINPILMAWGVAAFLRICLGSATVAAISTAGLVI-----PLLAVHP--.NTNLALITLATGAGSCICSHVNDASFWMIKDFFGLT-TKETLLSWTLMSTLLSISGLIFIL-LASLV
YOJA_BACSU/1-443 MPILIVAVG-VLILLFLIIKVKLNTFVSLIVVSFLVAIGLGMDINKIVLSIETGIGGQLGHLALVFGLGAMLGRLVSDAGGGYRIAITLIDKFGRKRIQAAVVVASFIIGIALFFEVGLVLLIPIVYAIAKELKMPFLYLGIPMAAALNVTHGFLPPHPAPTAISVAYGAHIGQVLLFGIIIA-VPTTVI---AGPLFNK---FAMKRFPGAYQKHGNLSGLGPRKEFQLDETPGFAISAVTSLFPVIFMAMATIFSLLLSEHSKGKD--.--IIEFIGTPGTAMLISLLLALYTMGYARKISMQEIGRSISESISQIAMMLLIIGGGGAFKQVLIDGGVGDYVADFFRQTNMSPLFVAWTIAAVLRLCLGSATVAALTTAGMAA-----PLMEAG---.SVNPALMVLATGAGSVIACHVNDAGFWMVKEFFGLS-MKETFQTWTLLTTVLSVTGLGCVL-LAGLV
GNTP_BACLI/1-447 MPLLIVAIG-IVALLLLIMGLKLNTFVSLIIVSFGVALALGMPLDDIVKTIEEGLGGTLGHIALIFGLGAMLGRLIADSGGAQRIAMTLVNKFGEENIQWAVVIASFIIGVALFFEVALVLLIPIVFAISKELEISISYLGIPMTAALSVTHGFLPPHPGPTAIAGELGANIGEVLLYGIIVA-IPTVLL---AGPLFTK---LAKKIVPQSFEKMGSIASLGEQKTFKLEETPGFGISVFTAMLPVIIMSISTVITLIQETMGLADNSL.LAAVRLIGNASTSMVISLLVAIYTMGIARKIPIKQVMDSCSTAITQIGMMLLIIGGGGAFKQVLINGGVGDYVAELFKGTAMSPILLAWVIAAILRISLGSATVAALSTTGLVL-----PMLGQS---.DVNLALVVLATGAGSVIASHVNDAGFWMFKEYFGLS-MKETFATWTLLETIIAVAGLGFTL-LLSLF
IDNT_ECOLI/1-437 MPLIIIAAG-VALLLILMIGFKVNGFIALVLVAAVVGFAEGMDAQAVLHSIQNGIGSTLGGLAMILGFGAMLGKLISDTGAAQRIATTLIATFGKKRVQWALVITGLVVGLAMFFEVGFVLLLPLVFTIVASSGLPLLYVGVPMVAALSVTHCFLPPHPGPTAIATIFEANLGTTLLYGFIIT-IPTVIV---AGPLFSK---LLTRFEKAPPE-----G-LFNPHLFSEEEMPSFWNSIFAAVIPVILMAIAAVCEITLPKTNTVRL--.--FFEFVGNPAVALFIAIVIAIFTLGRRNGRTIEQIMDIIGDSIGAIAMIVFIIAGGGAFKQVLVDSGVGHYISHLMTGTTLSPLLMCWTVAALLRIALGSATVAAITTAGVVL-----PIINVT---.HADPALMVLATGAGSVIASHVNDPGFWLFKGYFNLT-VGETLRTWTVMETLISIMGLLGVL-AINAV
GNTT_ECOLI/1-437 MPLVIVAIG-VILLLLLMIRFKMNGFIALVLVALAVGLMQGMPLDKVIGSIKAGVGGTLGSLALIMGFGAMLGKMLADCGGAQRIATTLIAKFGKKHIQWAVVLTGFTVGFALFYEVGFVLMLPLVFTIAASANIPLLYVGVPMAAALSVTHGFLPPHPGPTAIATIFNADMGKTLLYGTILA-IPTVIL---AGPVYAR---VLKGIDKPIPE------GLYSAKTFSEEEMPSFGVSVWTSLVPVVLMAMRAIAEMILPKGHAFLP--.--VAEFLGDPVMATLIAVLIAMFTFGLNRGRSMDQINDTLVSSIKIIAMMLLIIGGGGAFKQVLVDSGVDKYIASMMHETNISPLLMAWSIAAVLRIALGSATVAAITAGGIAA-----PLIATT---.GVSPELMVIAVGSGSVIFSHVNDPGFWLFKEYFNLT-IGETIKSWSMLETIISVCGLVGCL-LLNMV
GNUT_PSEAE/9-449 YLLLDALVT-IIGLIVLITRFKVHPFIALIIAAGFLGLTSGMPVEKIVKSFQDGFGGVLGFVGVILALGTMLGKLMADSGGADQIARTLIRAFGKERVHWSMMLAAFLVGIPLFFEIGFILLIPLVFIVARRSGVSLIKIGIPLLAGLSAVHGLVPPHPGPLLAIGVFGADIGKTILYGLIVA-LPTAAI---AGPLFGA---LVSRYIPGTPS--AELVEQIAHEP-ETQDLPSFGVTLATVLLPVFLMLLKTFADVAFPDGHAFRA--.--WMDMIGHPISALLLALLVALYTFGYARGFDSKKILRLLDQSLAPTAAIVMIIGAGGGFKQMLVASGVGDVIGHLAVNAQISPILLAWLVAAVIRIATGSATVATITGAGIVV-----PVIDLIPG-.VNR-ELLVLATGAGSLILSHVNDAGFWLVKQYFNMS-VSETFKTWTAMETILSVVGLVFIL-LLSLV
GNTP_ZYMMO/7-450 MLLLYALAS-IIILILMIAKWRLNPFVSLILVSIGMGAVTGMPLTKVLSAFQDGLGSGIGSTASVIALGTMLGKILAESGGAERIATTTIKIFGPKLIHWAMLVIAFIVGIPIFYQVGFILLIPLVFTLGRASGISLVKLTIPLCAGLATVHGLLPPHPGSMQCVEMLHADVGKTILYGFIVG-FPAAIL---AGPLYGN---WITPRIQLPAH--NPFAESLEGSSDQDKNLPGFWLTIFSILLPVLLMVFSSGANIFLPHGNNIRA--.--FMNFMGDPVVSLLIALLVSMVTLGFWRGFSSADLLKFTNDCLGPTAGILLLIGAGGGFSEILYRAGVSNAMADLSHVMHLSPIMLGFIIAAVIRVATGSQTVAMSMSGGMLA-----PIIFSTPG-.FHSPELLVLSIGAGSSILSHVNDGAFWLLKEYLNMT-VSQTFKTWTVSVTIASIAALILTFGLQALG
GNTP_ECOLI/4-446 LNILWVVFG-IGLMLVLNLKFKINSMVALLVAALSVGMLAGMDLMSLLHTMKAGFGNTLGELAIIVVFGAVIGKLMVDSGAAHQIAHTLLARLGLRYVQLSVIIIGLIFGLAMFYEVAFIMLAPLVIVIAAEAKIPFLKLAIPAVAAATTAHSLFPPQPGPVALVNAYGADMGMVYIYGVLVT-IPSVIC---AGLILPK---FLGNLERPTPS----FL-KADQPV-DMNNLPSFGVSILVPLIPAIIMISTTIANIWLVKDTPAWE--.--VVNFIGSSPIAMFIAMVVAFVLFGTARGHDMQWVMNAFESAVKSIAMVILIIGAGGVLKQTIIDTGIGDTIGMLMSHGNISPYIMAWLITVLIRLATGQGVVSAMTAAGIISAAILDPATGQLV--.GVNPALLVLATAAGSNTLTHINDASFWLFKGYFDLS-VKDTLKTWGLLELVNSVVGLIIVL-IISMV
DSDX_ECOLI/6-444 WVVSTLLIS-IVLIVLTIVKFKFHPFLALLLASFFVGTMMGMGPLDMVNAIESGIGGTLGFLAAVIGLGTILGKMMEVSGAAERIGLTLQRCRWLS-VDVIMVLVGLICGITLFVEVGVVLLIPLAFSIAKKTNTSLLKLAIPLCTALMAVHCVVPPHPAALYVANKLGADIGSVIVYGLLVG-LMASLI---GGPLFLK---FLGQRLPFKPVP----TEFADLKVRDEKTLPSLGATLFTILLPIALMLVKTIAELNMARESGLYI--.--LVEFIGNPITAMFIAVFVAYYVLGIRQHMSMGTMLTHTENGFGSIANILLIIGAGGAFNAILKSSSLADTLAVILSNMHMHPILLAWLVALILHAAVGSATVAMMGATAIVA-----PMLPLYP--.DISPEIIAIAIGSGAIGCTIVTDSLFWLVKQYCGAT-LNETFKYYTTATFIASVVALAGTF-LLSFI
GNTU_ECOLI/4-445 LTLVLTAVGSVLLLLFLVMKARMHAFLALMVVSMGAGLFSGMPLDKIAATMEKGMGGTLGFLAVVVALGAMFGKILHETGAVDQIAVKMLKSFGHSRAHYAIGLAGLVCALPLFFEVAIVLLISVAFSMARHTGTNLVKLVIPLFAGVAAAAAFLVPGPAPMLLASQMNADFGWMILIGLCAA-IPGMII---AGPLWGN---FISRYVELHIP------DDISEPHLGEGKMPSFGFSLSLILLPLVLVGLKTIAARFVPEGSTAYE--.--WFEFIGHPFTAILVACLVAIYGLAMRQGMPKDKVMEICGHALQPAGIILLVIGAGGVFKQVLVDSGVGPALGEALTGMGLPIAITCFVLAAAVRIIQGSATVACLTAVGLVM-----PVIEQLN-YsGAQMAALSICIAGGSIVVSHVNDAGFWLFGKFTGAT-EAETLKTWTMMETILGTVGAIVGMIAFQLL
YGBN_ECOLI/4-454 ITLLCIALAGVIMLLLLVIKAKVQPFVALLLVSLLVALAAGIPAGEVGKVMIAGMGGVLGSVTIIIGLGAMLGRMIEHSGGAESLANYFSRKLGDKRTIAALTLAAFFLGIPVFFDVGFIILAPIIYGFAKVAKISPLKFGLPVAGIMLTVHVAVPPHPGPVAAAGLLHADIGWLTIIGIAIS-IPVGVVGYFAAKIINKRQ-YAMSVEVLEQMQLAPASEEGATKLSDKINPPGVALVTSLIVIPIAIIMAGTVSATLMPPSHPLLG--.--TLQLIGSPMVALMIALVLAFWLLALRRGWSLQHTSDIMGSALPTAAVVILVTGAGGVFGKVLVESGVGKALANMLQMIDLPLLPAAFIISLALRASQGSATVAILTTGGLLS-----EAVMGLN--.PIQCVLVTLAACFGGLGASHINDSGFWIVTKYLGLS-VADGLKTWTVLTTILGFTGFLITWCVWAVI
Y1015_HAEIN/6-457 IPIIGLLIA-VFVLVFLVLRTRVHAFIAMLIAASIAGLVGGMSADETLNSITKGFGGTLGSIGIVIGLGVMMGSVLEVSGAAEKMAYSFIKMLGQKKEEWALAITGYVVSIPIFVDSAFVILYPVAKALAKNGKRSLLTLGVALAGGLAVTHHTVPPTPGPLGVAGLFGVDIGAMLLTGMCMAFLPVVGIVLYAKWLDKKYPNFNQEVFTEEELK---QKYDSYIESREKKELPSLGLSLLPIVLPIVLIFIKAVVHLFVKDVPEALTSIpYQIVSFLGHPVIVLALSVLISVYTLLPKADKNTTALH--LEEGVKTAGIILLVTGAGGALGAVLRDSGAGKQLAEQIANLPISPILIPFIVSTLVRFIQGSGTVAMITAASISS-----PILAQIP--.GVNMLLAAQAATMGSLFFGYFNDSLFWVVNRMMGINDVKKQMVVWSVPTTIAWGIGGISVI-LANLI