EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02434 alignment
(7 sequences with 253 aa)


RFNG_NOTVI/124-375 DALEFEDLFIAVKTTRKYHKTRLDLLLQTWISRAKQQTFIFTDGEDQDLRQRAGIQVINTNCSAMHTRQALCCKMAVEYDKFIESERKWFCHVDDDNYVNLFSLRHLLASFSHSQDVYLGRPSLDHPIEAIERVKSDGS-ASVRFWFATGGAGFCISRGLALKMSPWASMGNFITTAELVRLPDDCTIGYIIEGLLGVKMHHTPLFHSHLENLQRLPLQSVLKQVTLSYGGPDNKRNVVSVGGIFSLENDPTR
RFNG_CHICK/99-351 ESLELKDIFIAVKTTRKYHKTRLELLFQTWISRARGQTFIFTDWEDRELRLKAGDHMINTNCSAVHTRQALCCKMSVEYDKFLESGQKWFCHVDDDNYVNPRTLLRLLSAFSPSQDVYVGRPSLDHPIEAADHVQSDGSKTSVKFWFATGGAGFCISRGLALKMSPWASLGNFISTAERVRLPDDCTIGYIIEGLLEVKLLHSPLFHSHLENLQRLQGESVLQQVTLSYGDPENKHNVVSVGGVFGLQQDPTR
RFNG_XENLA/89-340 EPLQIKDLFIAVKTTKKYHGNRLNLLMQTWISRAKEQTFIFTDWEDQELRQKAGDQMVNTNCSAVHTRQALCCKMAVEYDKFVLSDKKWFCHLDDDNYLNLHALLDLLSTFSHSTDVYVGRPSLDHPVETVDRMKGDGS-GSLKFWFATGGAGFCISRGLALKMSPWASMGNFISTAEKVRLPDDCTIGYIIEGMLDVKMQHSNLFHSHLEHLQRLPTESLLKQVTLSYGGPDNKWNVVRVNGAFSLAEDPTR
RFNG_MOUSE/54-306 DRLQPDDVFIAVKTTRKNHGPRLRLLLRTWISRAPRQTFIFTDGDDPELQMLAGGRMINTNCSAVRTRQALCCKMSVEYDKFLESGRKWFCHVDDDNYVNPKSLLHLLSTFSSNQDIYLGRPSLDHPIEATERVQGGGTSNTVKFWFATGGAGFCLSRGLALKMSPWASLGSFMSTAERVRLPDDCTVGYIVEGLLGARLLHSPLFHSHLENLQRLPSGAILQQVTLSYGGPENPHNVVNVAGSFNIQQDPTR
LFNG_MOUSE/107-357 EVLSPRDVFIAVKTTRKFHRARLDLLFETWISRHKEMTFIFTDGEDEALAKLTG-NVVLTNCSSAHSRQALSCKMAVEYDRFIESGKKWFCHVDDDNYVNLRALLRLLASYPHTQDVYIGKPSLDRPIQATERISEHKV-RPVHFWFATGGAGFCISRGLALKMGPWASGGHFMSTAERIRLPDDCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTTELHEQVTLSYGMFENKRNAVHIKGPFSVEADPSR
MFNG_HUMAN/49-300 PKLQLHDVFIAVKTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRT-RLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSR
FNG_DROME/143-394 PVTELDDIFISVKTTKNYHDTRLALIIKTWFQLARDQTWFFTDTDDHYYQEKTKGHLINTKCSQGHFRKALCCKMSAELDVFLESGKKWFCHFDDDNYVNVPRLVKLLDEYSPSVDWYLGKPSISSPLEIHLDSKNTTTNKKITFWFATGGAGFCLSRALTLKMLPIAGGGKFISIGDKIRFPDDVTMGFIIEHLLKVPLTVVDNFHSHLEPMEFIRQDTFQDQVSFSYAHMKNQWNVIKVDG-FDMKTDPKR