EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02404 alignment
(4 sequences with 288 aa)


SCF_PIG/1-274 MKKTQTWIITCIYLQLLLFNPLVRTQGICRNRVTDDVKDVTKLVANLPKDYKITLKYVPGMDVLPSHCWISEMVEQLSVSLTDLLDKFSNISEG---LSNYSIIDKLVKIVDDLVECMEEHSFEN-VKKSSKSPEPRLFTPEKFFGIFNRSIDAFKDLEMVAPKTSECVI-SSTLTPEKDSRVSVTKPFMLPPVAASSLRNDS------SSSNRKASDSIEDSSLQWAAVALPAFFSLVIGFAFGALYWKKKQP-NLTRTVENIQIN--EEDNEISMLQEKEREFQEV
SCF_RAT/1-273 MKKTQTWIITCIYLQLLLFNPLVKTQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEG---LSNYSIIDKLGKIVDDLVACMEENAPKN-VKESLKKPETRNFTPEEFFSIFNRSIDAFKD-FMVASDTSDCVL-SSTLGPEKDSRVSVTKPFMLPPVAASSLRNDS------SSSNRKAAKSPEDPGLQWTAMALPALISLVIGFAFGALYWKKKQS-SLTRAVENIQIN--EEDNEISMLQQKEREFQEV
SCF_CHICK/1-287 MKKAQTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYLITLKYVPKMDSLPNHCWLHLMVPEFSRSLHNLLQKFSDISDMSDVLSNYSIINNLTRIINDLMACLAFDKNKDFIKENGHLYEEDRFIPENFFRLFNSTIEVYKE-FADSLDKNDCIMPSTVETPENDSRVAVTKTISFPPVAASSLRNDSIGSNTSSNSNKEALGFISSSSLQGISIALTSLLSLLIGFILGAIYWKKTHPKSRPESNETIQCHGCQEENEISMLQQKEKEHLQV
SCF_COTJA/1-287 MKKAQTWIITCFCLQLLLLNPLVKTQSSCGNPVTDDVNDIAKLVGNLPNDYLITLKYVPKMDSLPNHCWLHLMVPEFSRSLHNLLQKFVDISDMSDVLSNYSIINNLTRIINDLMACLAFDKNKDFIKENGHLYEEDRFIPENFFRLFNRTIEVYKE-FADSLDKNDCIMPSTVETPENDSRVAVTKTISFPPVAASSLRNDSIGSNTSSNSNKEALGFISSSSLQGISIALTSLLSLLIGFILGVIYWKKTHPKSRPESNETTQCHGCQEENEISMLQQKEKEHLQV