EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02357 alignment
(13 sequences with 45 aa)


NUSG_CHLTR/1-44 MFKWYVVQVFTAQEKKVKKSLEDFKE-ASGMSDFIQQIILPSENV
NUSG_HELPY/1-44 MMDWYAIQTYSGSEQSVKKAIENLAN-DHNIRDRIQEIIVPTEDI
NUSG_MYCTU/46-89 PGDWYVVHSYAGYENKVKANLETRVQ-NLDVGDYIFQVEVPTEEV
NUSG_STRCO/110-153 PGEWYVIHTYAGYENRVKTNLEQRAV-SLNVEDYIFQAEVPQEEV
NUSG_STAAM/7-50 AKRWYAVHTYSGYENKVKKNLEKRVE-SMNMTEQIFRVVIPEEEE
NUSG_BACSU/2-45 EKNWYVVHTYSGYENKVKANLEKRVE-SMGMQDKIFRVVVPEEEE
NUSG_THEMA/2-45 KKKWYIVLTMSGYEEKVKENIEKKVE-ATGIKNLVGRIVIPEEVV
NUSG_SYNY3/20-63 EGHWFAVQVASGCEKRVKLNLEQRIH-TLDVADRILQVEIPKTPI
NUSG_RICPR/17-60 VKQWYVVHTASGAEKRIKEDILRKIA-KQKMTDFFEDILIPVFGV
NUSG_HAEIN/9-52 KKRWYVLQAFSGFESRVALTLREYIK-QQQMEDQFGEVLVPTEEV
NUSG_ECOLI/5-48 KKRWYVVQAFSGFEGRVATSLREHIK-LHNMEDLFGEVMVPTEEV
NUSG_TREPA/2-46 AKEWYILHTFSGREARVERAVRMLVEHARIPTNVIFDIKIPEELL
NUSG_BORBU/2-45 SRAWYVVQTYSQYEKKIEQDIRLLIN-EGVFGGVVLDVKAPIEKV