EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02337 alignment
(4 sequences with 93 aa)


O41288_9RETR/1-91 MGQELSQHQI--YVGQLKEALKIRGVKVKGNDLFKFFDFVKDTCPWFPQEGTIDIKRWRRVGDCFQDYYNTFGPEKIPVTAFSYWNLIRDLID
GAG_SMRVH/1-93 MGQASSHSENDLFISHLKESLKVRRIRVRKKDLVSFFSFIFKTCPWFPQEGSIDSRVWGRVGDCLNDYYRVFGPETIPITTFNYYNLIRDVLT
GAG_JSRV/1-90 MG---HTHSRQLFVHMLSVMLKHRGITVSKTKLINFLSFIEEVCPWFPREGTVNLETWKKVGEQIRTHYTLHGPEKVPVETLSFWTLIRDCLD
GAG_MMTVB/1-92 MGVSGSKGQK-LFVSVLQRLLSERGLHVKESSAIEFYQFLIKVSPWFPEEGGLNLQDWKRVGREMKRYAAEHGTDSIPKQAYPIWLQLREILT