EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02334 alignment
(3 sequences with 122 aa)


RTP_BACVA/1-122 MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSDNF
O85146_BACAM/1-122 MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKPIGFKPNHTEVYRSLHELLDDGILKQVKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSDNF
O85145_BACAT/1-122 MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKQIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKIELDRCKNLIEKALSDNF