EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02295 alignment
(8 sequences with 67 aa)


O72122_9POXV/1-65 MACECASLILELLRKSDDKLPAKQIAKELGIS--KHEANRQLYRLLDSDEVCCEDGNPPRWFVECAP
VE03_VACCC/7-72 DERSDAEIVCAAIKNIG-IEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMTTEA
O12982_XENLA/363-427 DMAGNKEKVCEFLYNSP-PSTTLIIRKNVGISK-LPELNQILNTLEKQGEACKASTNPVKWTLTDKK
DSRAD_HUMAN/295-359 DMAEIKEKICDYLFNVS-DSSALNLAKNIGLTK-ARDINAVLIDMERQGDVYRQGTTPPIWHLTDKK
O12983_XENLA/112-178 SRDPLENILLTFFRGQGDTQTFTAKALAWQFKVKKKHINYFLYKFQTKGLLCKNSGTPPLWKISSIT
O12982_XENLA/259-324 SHDLLENNLLTFFKEIG-TKTFTAKALAWQFKVEKKRINHFLYTFETKGLLCRYPGTPPLWRVFSIA
DSRAD_RAT/137-203 ISQNPEQKVLNRLEELGEGKATTAYALARELRTPKKDINRILYSLERKGKLHRGVGKPPLWSLVPLS
DSRAD_HUMAN/135-201 IYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVST