EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02294 alignment
(2 sequences with 62 aa)


DN71_SULSO/1-62 ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK
DN72_SULAC/1-61 AKVRFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNG-KTGRGAVSEKDAPKELMDMLARAE