EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02269 alignment
(7 sequences with 93 aa)


TAF13_YEAST/9-101 NLFNKDVSSLLYAYGDVPQPLQATVQCLDELVSGYLVDVCTNAFHTAQNSQRNKLRLEDFKFALRKDPIKLGRAEELIATNKLITEAKKQFNE
O60076_SCHPO/16-105 HLFTKDLKSLMYAFGDDVNPAPDSINVLEEIVVDYINEMCLEAARIAGNR--NKVKVDDFKFALRDDPKKLGRVEELLRSSNFSVAGHP-FQG
TAF13_HUMAN/30-119 RLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQG---RVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDE
Q17957_CAEEL/27-116 HVLRRDLRSMVYGFGDDKEPYDKTLDTLEAIVLNYIKELCQLAMKVGKPD---KMALEDIHYLIRRDPKKFSRVKDLLSMSEELKKARKQFED
SPT3_YEAST/5-96 HKYRVEIQQMMFVSGEINDPPVETTSLIEDIVRGQVIEILLQSNKTAHLRGSRSILPEDVIFLIRHDKAKVNRLRTYLSWKDLR-KNAKDQDA
SPT3_SCHPO/8-99 SKYRVEIQQMMFILGEVQDPLPETTQLVEELIRGQVMEMLIQANELALRRGSRSITVEDLFFLIRHDRAKVNRLKTYLSWKEVR-KKAKEQDA
SUPT3_HUMAN/106-198 ISFATELQSMMYSLGDARRPLHETAVLVEDVVHTQLINLLQQAAEVSQLRGARVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSKIVKGIDE