EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02267 alignment
(5 sequences with 249 aa)


NADA_APLKU/28-272 TPELQNVFLGRCKDYEITRYLTIL-PR-VKSDCRALWTNFFKAFSFKAPCNLDLGSYKDFFQRAQQTLPKNKVMFWSGVYDEAHDFADDGRKYITLEDTLPGYMLNSLVWCGQRDKPGFNQKVCP-DFKDCPVQARESFWGTASSSYAHSAEGDVTYMVDGSNPKVPAYRPDSFFGKYELPNLT-NKVTKVKVIVLHQLGQKIIERCGAGSLLDLEMVVKAKKFGFDCVENPKSVLFLLCADNPNAREC
CD38_HUMAN/56-296 TKRFPETVLARC-----VKYTEIH-PEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLNGSRSK--IFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC
CD38_RAT/58-299 TKHFADIILGRC-----LIYTQILRPEMRDQDCKKILSTFKRGFISKNPCNITNEDYAPLVKLVTQTIPCNKTLFWSKSKHLAHQYTWIQGKMFTLEDTLLGYIADDLRWCGDPSTSDMNYDSCPHWSENCPNNPVAVFWNVISQKFAEDACGVVQVMLNGSLSE--PFYRNSTFGSVEVFNLDPNKVHKLQAWVMHDIKGTSSNACSSPSINELKSIVNKRNMIFACQDNYRPVRFLQCVKNPEHPSC
BST1_MOUSE/35-273 TPHLQSIFLGRC-----AEYTTLLSL--GNKNCTAIWEAFK-GVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCP-TSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKG-AYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDC
BST1_HUMAN/40-280 SAHLRDIFLGRC-----AEYRALLSPEQRNKNCTAIWEAFK-VALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCP-TSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTG-AYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDC