EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02244 alignment
(10 sequences with 82 aa)


O97434_HELAM/25-99 AVYQVDVASMDQVKLVHDFENDL--MLDVWSD-----AVPGRPGKVLVPKFKREIFENFLKQSGVQYKLEVENVKEQLELED
CBPA1_BOVIN/24-101 QVLRITAADEAEVQTVKELEDLEHLQLDFWRG----PGQPGSPIDVRVPFPSLQAVKVFLEAHGIRYRIMIEDVQSLLDEEQ
CBPA1_RAT/24-101 QVLRISAADEAQVQKVKELEDLEHLQLDFWRD----AARAGIPIDVRVPFPSIQSVKAFLEYHGISYEIMIEDVQLLLDEEK
CBPA2_RAT/24-101 QVLEIIPSHEEQIRTLLQLEAEEHLELDFWKS----PTIPGETVHVRVPFASIQAVKVFLESQGIDYSIMIEDVQVLLDQER
Q23318_CAEEL/34-111 QVLRAHATDVPQLKALRDIHERTQHDLDFWQT----PSKVGHRADIMVDEDRMEWLDSVLKNSNISYDVIIEDVGKLILEKE
CBPC_MOUSE/25-104 KVFRVKLQNEKHASVLKNLTQSI--ELDFWYPDAIHDIAVNMTVDFRVSEKESQTIQSTLEQHKIHYEILIHDLQEEIEKQF
CBPC_HUMAN/25-104 KVFRVKPQDEKQADIIKDLAKTN--ELDFWYPGATHHVAANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQF
CBPB_RAT/24-103 RVYRVSVHGEDHVNLIQELANTK--EIDFWKPDSATQVKPLTTVDFHVKAEDVADVENFLEENEVHYEVLISNVRNALESQF
CBPB_CANFA/25-104 KVFRVNVEDENHINLLHTLASTT--QIDFWKPDSVTQIKPHSTADFRVKAEDILTVEDFLKQNELHYEVLINNLRLVLEGQF
Q15114_HUMAN/27-106 QVLAALPRTSRQVQVLQNLTTTY--EIVLWQPVTADLIVKKKQVHFFVNASDVDNVKAHLNVSGIPCSVLLADVEDLIQQQI