EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02224 alignment
(14 sequences with 164 aa)


KCY_MYCTU/62-220 ETIASTVQMSLGYDPDGDS-.CYLAGEDVSVE-IRGDAVTRAVSAVSSVPAVRTRLVELQRTMAEG.PGSIVVEGRDIGTVVFPDAPVKIFLTASAETRARRRNAQNVAAG-LADDYDGVLADVRRRDHLDSTRAVSPLQAAGDAVIVDTSDMTEAEVVAHLLE
KCY_MYCLE/59-213 GESVWKVQMLS----DHDR-.YFLGGEDVSSE-IRTEEVTQAVSAVSAIPAVRVRLVDLQRQMAEG.RGSVVVEGRDIGTVVLPDAPVKIFLTASPETRARRRNDQNVASG-SADDYDRVLAEVRRRDHLDSTRAVSPLYVAQDAMIVDTSKMAEAEVIAHLMD
KCY_SYNY3/62-222 AELTSGAEIELMPRPAPQLTgVKVNGQDVSDA-IRTPAVTQLVSTIAAQGAVRAKLLKLQRKYGD-.QGGIVAEGRDIGTQVFPNAELKIFLTASVQERARRRLKDFEAQGNQAVDLAQLEADIAHRDHLDSTRAIAPLQKAVDAVEIITDNLTIAEVVETIIE
KCY_BACSU/60-217 AELLKRTDIELITTKDGQK-.VFVNGTDVTEA-IRTDEISNQVSIAAKHRSVREEMVKRQQQLGE-.KGGVVMDGRDIGTHVLPNAEVKIFLLASVEERAKRRYEENVKKG-FDVNYETLIEEIARRDKLDSEREVSPLRKAEDALEIDTTSLSIQEVADKILE
KCY1_HAEIN/56-213 AELARHLDIQFIPQ-NGEVS.ILLAGMDVSRL-IRTQEVADAASKVAVFQKVRSALLQLQQDFAK-.NDGLIADGRDMGTVVFPNAQVKLFLDASAEERAKRRYKQLQNKG-INGNFAQILAEIKERDFRDRNREVAPLKPADDALLLDSTTLSIDEVIDQALA
KCY_ECOLI/61-218 VPLASHLDVRFVST-NGNLE.VILEGEDVSGE-IRTQEVANAASQVAAFPRVREALLRRQRAFRE-.LPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKG-FSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQ
KCY_RICPR/70-212 IALSKELKLDN---------.----NIDLENE-----DIGDIASQIAVISDVRNNLNENLINLVKT.TPRIIMEGRDIGTVVAPDADLKIFITASPYVRAIRRYNQLQAKG-KTCILDEIIQQIILRDKRDKERKAGPLLPALGAFIIDTSKLSAIEIVEEVTN
KCY_AQUAE/52-210 IDKLFSLPVKVVPKIGKTE-.VYIEGKPVNEEDLRSEEVGKRASELGSIPEFRERINKLFKEIIN-.NKQMVVEGRDAGTHIIPEAPVKVFITASPEERAKRRYEQLKELG-YEVSFEEILQKILERDKRDMERPKYPFKPAEDAVIIDTTRKSVEEVVEEVLK
KCY_CHLTR/53-209 EDFLASPPFSFSFSKDSPLQ.AFYGDRLLTSE-LSSQEVANFASLFSKEPLVRAYMQTLQKQYAT-.VGNCVFEGRDMGSKVFPHAEVKIFLTAKPEIRAERRLKDLPQGSLSK---EALMAELIARDQADQQRECDPLVIPQDATVIDSSDLTISQILEKILP
KCY_CHLPN/53-209 TKFLEEPPFSFTFATGQPLE.SFFNGHLLTSE-LTTQEVANAASELSQLPEVRAFMQDLQRRYAQ-.LGNCVFEGRDMGSKVFPNADLKIFLTSSPEVRAQRRLKDLPEGTLSP---EQLQAELVKRDAADAQRAHDPLVIPENGIVIDSSDLTIRQVLEKILA
KCY_MYCPN/54-209 LLKVIN-QINWRFEHEK---.VFYNNADISEV-ILNQEIAQLASNLATNPEVRKMAVLRQQALAK-.NTNIVMDGRDIGTVVLKDAQLKYFLDAKPEIRAQRRAQDLGIAYDSDKAFQELVAEIKHRDAVDTSRTADPLVQAPDAIYIDSSNLTFQQVVELMVQ
KCY_MYCGE/54-209 FLKIIN-QINWRFEKDA---.VYYNNADITTV-ITTQSVANIASKIAVDPNIRKIAVIKQQKLAE-.NKNIVMDGRDIGTVVLKNAQLKFFLDAKVEIRAQRRLQDMGISLSNEKKLKELIQELKQRDQIDSSRTADPLKKAQDAIYLDTSELSFDAVVKQTLK
O83303_TREPA/129-281 YWVSFARTVALSYRAG----.VMYVGEENVESLLRSDEVESAVSYFAAMPAIRAIMTGKIRSAVC-.GARVVCEGRDLTTVVFVDADLKCYLDASIEARVARRWAQGTSRL-SK---QELEQRMRARDAHDRARTVGGLRCAPDALYVDTSCLTIEEVCERIAR
KCY1_BORBU/59-211 LNLILENDISFNNFA-----.FLLNGENVENQ-ILNDKIDFQVSFYSSYVGIRNIVNKKLREVVKFsDDNYIIEGRDITTVVFPESEFKIYLDASVKVRALRRYKQRNGNE----TLEELERTLKRRDDVDKKKQYGKLKLSKGVFYLDTSYKGLDDVCNIIIE